Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PBH8

Protein Details
Accession M7PBH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99PSFRLIAKSRHKTHPKSKTLFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 8, E.R. 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021149  OligosaccharylTrfase_OST3/OST6  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
Pfam View protein in Pfam  
PF04756  OST3_OST6  
Amino Acid Sequences MRINLQKLYLILAFLSYVFSTQDLVLDFLKRAESNNGIIQLDGTSIYSILTKPRNYSIVVMFTTNSIEYNCYVCKKLYPSFRLIAKSRHKTHPKSKTLFFGVLEYLENANIFAQLQLTKIPTIIVYPATVGPAALKNSKPLMLNIRDGDISSEWLAQAISQKINEPIHIVQFLNYGKIVFYSFIAFLSLLFFKITHSFIFYIMSRKELWLIFSLACILIFNSGYMLVKIRKSPFNGQDDNSPSYILRSSHAQYGIESHIIVVTYLILMFTVILLTVFTPKIANKRKQTALIILLIIFQFVIFSFLLHIFRMKNRNYPFKLLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.08
4 0.08
5 0.08
6 0.09
7 0.1
8 0.09
9 0.11
10 0.1
11 0.12
12 0.13
13 0.14
14 0.14
15 0.14
16 0.17
17 0.15
18 0.17
19 0.2
20 0.22
21 0.24
22 0.28
23 0.3
24 0.27
25 0.27
26 0.25
27 0.2
28 0.17
29 0.13
30 0.1
31 0.07
32 0.06
33 0.07
34 0.08
35 0.08
36 0.14
37 0.2
38 0.21
39 0.24
40 0.28
41 0.31
42 0.31
43 0.34
44 0.31
45 0.3
46 0.29
47 0.27
48 0.23
49 0.21
50 0.21
51 0.17
52 0.14
53 0.1
54 0.1
55 0.1
56 0.13
57 0.15
58 0.16
59 0.18
60 0.18
61 0.21
62 0.25
63 0.31
64 0.38
65 0.4
66 0.42
67 0.46
68 0.5
69 0.52
70 0.5
71 0.53
72 0.53
73 0.58
74 0.6
75 0.65
76 0.7
77 0.72
78 0.79
79 0.81
80 0.8
81 0.77
82 0.74
83 0.71
84 0.65
85 0.59
86 0.49
87 0.4
88 0.31
89 0.26
90 0.22
91 0.16
92 0.12
93 0.1
94 0.09
95 0.07
96 0.07
97 0.06
98 0.06
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.07
109 0.08
110 0.08
111 0.07
112 0.06
113 0.07
114 0.07
115 0.08
116 0.07
117 0.07
118 0.07
119 0.08
120 0.1
121 0.12
122 0.12
123 0.14
124 0.15
125 0.17
126 0.17
127 0.17
128 0.22
129 0.22
130 0.25
131 0.23
132 0.24
133 0.21
134 0.21
135 0.2
136 0.13
137 0.12
138 0.09
139 0.09
140 0.07
141 0.07
142 0.07
143 0.06
144 0.09
145 0.09
146 0.09
147 0.09
148 0.1
149 0.14
150 0.14
151 0.14
152 0.14
153 0.13
154 0.13
155 0.15
156 0.14
157 0.1
158 0.14
159 0.13
160 0.11
161 0.11
162 0.1
163 0.08
164 0.09
165 0.09
166 0.06
167 0.06
168 0.07
169 0.07
170 0.07
171 0.07
172 0.07
173 0.06
174 0.08
175 0.07
176 0.06
177 0.07
178 0.06
179 0.07
180 0.09
181 0.1
182 0.08
183 0.11
184 0.11
185 0.11
186 0.13
187 0.13
188 0.16
189 0.15
190 0.17
191 0.15
192 0.15
193 0.18
194 0.16
195 0.17
196 0.13
197 0.15
198 0.13
199 0.13
200 0.13
201 0.1
202 0.1
203 0.08
204 0.06
205 0.06
206 0.06
207 0.05
208 0.05
209 0.06
210 0.06
211 0.06
212 0.09
213 0.11
214 0.12
215 0.17
216 0.21
217 0.25
218 0.3
219 0.39
220 0.44
221 0.49
222 0.51
223 0.48
224 0.51
225 0.51
226 0.49
227 0.41
228 0.34
229 0.26
230 0.24
231 0.25
232 0.18
233 0.15
234 0.16
235 0.18
236 0.22
237 0.24
238 0.23
239 0.21
240 0.24
241 0.24
242 0.2
243 0.18
244 0.13
245 0.12
246 0.12
247 0.11
248 0.08
249 0.05
250 0.05
251 0.05
252 0.05
253 0.04
254 0.04
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.04
262 0.07
263 0.07
264 0.07
265 0.09
266 0.12
267 0.22
268 0.32
269 0.41
270 0.47
271 0.56
272 0.61
273 0.66
274 0.68
275 0.64
276 0.58
277 0.52
278 0.44
279 0.35
280 0.31
281 0.24
282 0.2
283 0.13
284 0.09
285 0.06
286 0.05
287 0.08
288 0.06
289 0.06
290 0.09
291 0.11
292 0.12
293 0.13
294 0.16
295 0.16
296 0.24
297 0.32
298 0.34
299 0.41
300 0.48
301 0.59
302 0.62
303 0.67