Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S8N9

Protein Details
Accession F4S8N9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-57QKQQRINLRRGKRRRAQLRQRRRQPLLSRTSHydrophilic
NLS Segment(s)
PositionSequence
31-49RINLRRGKRRRAQLRQRRR
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_94982  -  
Amino Acid Sequences MKKPVPQMIRKEATPATGSSHQHKSNQKQQRINLRRGKRRRAQLRQRRRQPLLSRTSHILMMSILIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.31
3 0.28
4 0.29
5 0.31
6 0.32
7 0.38
8 0.37
9 0.43
10 0.5
11 0.51
12 0.55
13 0.62
14 0.65
15 0.64
16 0.68
17 0.72
18 0.71
19 0.72
20 0.71
21 0.71
22 0.73
23 0.75
24 0.79
25 0.75
26 0.79
27 0.8
28 0.82
29 0.85
30 0.86
31 0.88
32 0.9
33 0.93
34 0.92
35 0.87
36 0.85
37 0.83
38 0.82
39 0.8
40 0.74
41 0.68
42 0.63
43 0.59
44 0.51
45 0.42
46 0.33
47 0.23