Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NPP5

Protein Details
Accession M7NPP5   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
211-231FCSDTCKTRSLKKKDKYSAYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR024610  ING_N_histone-binding  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0032991  C:protein-containing complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12998  ING  
CDD cd16858  ING_ING3_Yng2p  
cd15505  PHD_ING  
Amino Acid Sequences MEDAAFVLLEYLNSLDNLPSEIAHIYEELKSKELKFQKIHKRICTRDNSIHKHIRSYGSLVVNPKETQYIPKIQADFIYAIKIQEEKLFLSKKSLDLLQRHLRRLDNEIKRLHLDGQIAPETTKNTYSPFSTLTSESRTLVIPRKRRALSIRMSDSDPDSISNDNDDSQVYCFCQQISYGEMIACDDSECVFEWFHYGCVGLKAPPNGKWFCSDTCKTRSLKKKDKYSAYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.1
5 0.09
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.1
13 0.13
14 0.17
15 0.17
16 0.19
17 0.21
18 0.21
19 0.3
20 0.35
21 0.4
22 0.43
23 0.52
24 0.61
25 0.69
26 0.76
27 0.76
28 0.8
29 0.78
30 0.8
31 0.78
32 0.75
33 0.75
34 0.77
35 0.75
36 0.73
37 0.76
38 0.67
39 0.63
40 0.6
41 0.54
42 0.45
43 0.41
44 0.39
45 0.33
46 0.35
47 0.34
48 0.31
49 0.3
50 0.28
51 0.25
52 0.22
53 0.19
54 0.2
55 0.22
56 0.26
57 0.27
58 0.3
59 0.31
60 0.29
61 0.29
62 0.27
63 0.24
64 0.17
65 0.17
66 0.13
67 0.12
68 0.12
69 0.12
70 0.1
71 0.11
72 0.12
73 0.1
74 0.15
75 0.17
76 0.17
77 0.2
78 0.21
79 0.2
80 0.21
81 0.23
82 0.23
83 0.23
84 0.31
85 0.36
86 0.39
87 0.41
88 0.42
89 0.4
90 0.37
91 0.4
92 0.42
93 0.4
94 0.41
95 0.4
96 0.39
97 0.38
98 0.38
99 0.33
100 0.25
101 0.21
102 0.15
103 0.17
104 0.16
105 0.15
106 0.15
107 0.14
108 0.12
109 0.12
110 0.12
111 0.1
112 0.1
113 0.12
114 0.12
115 0.13
116 0.14
117 0.15
118 0.15
119 0.17
120 0.17
121 0.19
122 0.19
123 0.19
124 0.17
125 0.16
126 0.17
127 0.23
128 0.29
129 0.33
130 0.37
131 0.44
132 0.44
133 0.48
134 0.51
135 0.5
136 0.51
137 0.52
138 0.52
139 0.46
140 0.46
141 0.43
142 0.39
143 0.33
144 0.26
145 0.18
146 0.14
147 0.13
148 0.12
149 0.13
150 0.12
151 0.11
152 0.11
153 0.11
154 0.1
155 0.1
156 0.11
157 0.11
158 0.12
159 0.12
160 0.11
161 0.11
162 0.11
163 0.12
164 0.13
165 0.13
166 0.12
167 0.12
168 0.12
169 0.12
170 0.11
171 0.1
172 0.08
173 0.06
174 0.06
175 0.07
176 0.08
177 0.09
178 0.08
179 0.08
180 0.11
181 0.11
182 0.11
183 0.11
184 0.1
185 0.1
186 0.13
187 0.14
188 0.14
189 0.18
190 0.24
191 0.27
192 0.32
193 0.38
194 0.37
195 0.38
196 0.4
197 0.39
198 0.39
199 0.44
200 0.44
201 0.44
202 0.48
203 0.53
204 0.51
205 0.57
206 0.63
207 0.65
208 0.7
209 0.73
210 0.78
211 0.82