Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PCH2

Protein Details
Accession M7PCH2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-44ELSRVRDKFEREKSKKLDKSSBasic
252-281LEWAYDKRQKKLNERKKEIEKRRHKNIGEQBasic
NLS Segment(s)
PositionSequence
258-277KRQKKLNERKKEIEKRRHKN
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MTLSGKNNETIAVSSASSIGLLAELSRVRDKFEREKSKKLDKSSNIYEKKKTLLTKSNVGVEYRAAKDRYEQENILEHEIKASRIALKRKAIQYQMMKRGAHDMNIKGVAAENLLVDFDRKWAEHQELETSSSSESEVDEENNPWVEYIDEFGRTRKVRKIDLPREITPEQEIPKNIIYGDFIQPFNPDEEQVRKILDEPEESAETFYDSTKEIRTKGVGFYQFSKDAQKREEERKALQEEHRLTELMKQNLEWAYDKRQKKLNERKKEIEKRRHKNIGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.09
6 0.07
7 0.05
8 0.05
9 0.05
10 0.07
11 0.08
12 0.12
13 0.17
14 0.17
15 0.22
16 0.27
17 0.34
18 0.41
19 0.51
20 0.59
21 0.6
22 0.7
23 0.74
24 0.8
25 0.8
26 0.78
27 0.77
28 0.73
29 0.75
30 0.75
31 0.78
32 0.76
33 0.74
34 0.72
35 0.64
36 0.62
37 0.59
38 0.54
39 0.52
40 0.52
41 0.52
42 0.54
43 0.55
44 0.57
45 0.52
46 0.48
47 0.4
48 0.33
49 0.33
50 0.28
51 0.3
52 0.24
53 0.23
54 0.28
55 0.35
56 0.38
57 0.38
58 0.36
59 0.33
60 0.38
61 0.4
62 0.39
63 0.33
64 0.27
65 0.25
66 0.25
67 0.23
68 0.18
69 0.17
70 0.18
71 0.22
72 0.28
73 0.32
74 0.37
75 0.43
76 0.47
77 0.52
78 0.49
79 0.5
80 0.54
81 0.56
82 0.59
83 0.58
84 0.53
85 0.48
86 0.52
87 0.45
88 0.4
89 0.35
90 0.27
91 0.25
92 0.26
93 0.25
94 0.18
95 0.17
96 0.13
97 0.09
98 0.08
99 0.05
100 0.04
101 0.04
102 0.04
103 0.05
104 0.04
105 0.06
106 0.06
107 0.07
108 0.08
109 0.11
110 0.14
111 0.15
112 0.15
113 0.17
114 0.17
115 0.19
116 0.18
117 0.16
118 0.13
119 0.12
120 0.11
121 0.08
122 0.07
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.08
129 0.09
130 0.09
131 0.07
132 0.07
133 0.06
134 0.05
135 0.07
136 0.07
137 0.08
138 0.09
139 0.1
140 0.16
141 0.17
142 0.2
143 0.23
144 0.27
145 0.29
146 0.38
147 0.48
148 0.51
149 0.59
150 0.62
151 0.58
152 0.61
153 0.56
154 0.49
155 0.4
156 0.34
157 0.27
158 0.24
159 0.23
160 0.19
161 0.2
162 0.19
163 0.17
164 0.14
165 0.14
166 0.13
167 0.17
168 0.17
169 0.16
170 0.16
171 0.17
172 0.18
173 0.18
174 0.15
175 0.12
176 0.13
177 0.17
178 0.18
179 0.18
180 0.18
181 0.16
182 0.17
183 0.2
184 0.19
185 0.16
186 0.17
187 0.19
188 0.2
189 0.2
190 0.19
191 0.15
192 0.14
193 0.13
194 0.11
195 0.09
196 0.08
197 0.1
198 0.14
199 0.17
200 0.17
201 0.19
202 0.22
203 0.23
204 0.25
205 0.31
206 0.3
207 0.3
208 0.33
209 0.35
210 0.35
211 0.34
212 0.4
213 0.37
214 0.37
215 0.38
216 0.42
217 0.44
218 0.51
219 0.59
220 0.55
221 0.56
222 0.6
223 0.62
224 0.59
225 0.58
226 0.57
227 0.52
228 0.51
229 0.48
230 0.41
231 0.36
232 0.38
233 0.41
234 0.36
235 0.33
236 0.29
237 0.32
238 0.33
239 0.35
240 0.3
241 0.26
242 0.32
243 0.4
244 0.45
245 0.46
246 0.52
247 0.57
248 0.65
249 0.73
250 0.74
251 0.76
252 0.81
253 0.86
254 0.89
255 0.92
256 0.92
257 0.92
258 0.92
259 0.9
260 0.92
261 0.92