Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NNU9

Protein Details
Accession M7NNU9    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-168SLTIWHKKWEKNNWKKINTKSVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017067  RNase_H1_euk  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0000287  F:magnesium ion binding  
GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
CDD cd09280  RNase_HI_eukaryote_like  
Amino Acid Sequences MNIFQRILKKNISLYNGLLNNYKRNSFSDMKNDKDRSNFVLKYIKKDINISSSICNFEQKKISKNNYIEIYTDGSSHYYEGGKVITGIGVYFGDNDKRKVNISERIFDKKQTSQRAEIIAVIRAIESVSDDEDIRINTDSKYTINSLTIWHKKWEKNNWKKINTKSVKNKDLLEKAVELIKKRSGCTELKYVSSHSNIHGNKQADYLANMSISFQKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.41
4 0.39
5 0.39
6 0.36
7 0.38
8 0.39
9 0.39
10 0.33
11 0.33
12 0.39
13 0.38
14 0.42
15 0.45
16 0.49
17 0.53
18 0.61
19 0.61
20 0.57
21 0.57
22 0.54
23 0.49
24 0.51
25 0.45
26 0.4
27 0.46
28 0.44
29 0.46
30 0.51
31 0.49
32 0.42
33 0.45
34 0.43
35 0.39
36 0.4
37 0.35
38 0.31
39 0.29
40 0.3
41 0.27
42 0.3
43 0.26
44 0.27
45 0.33
46 0.33
47 0.38
48 0.44
49 0.5
50 0.52
51 0.53
52 0.56
53 0.52
54 0.5
55 0.43
56 0.36
57 0.33
58 0.25
59 0.22
60 0.17
61 0.13
62 0.12
63 0.12
64 0.11
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.1
81 0.12
82 0.14
83 0.15
84 0.15
85 0.17
86 0.2
87 0.23
88 0.27
89 0.29
90 0.33
91 0.34
92 0.4
93 0.4
94 0.38
95 0.37
96 0.35
97 0.39
98 0.41
99 0.41
100 0.38
101 0.39
102 0.39
103 0.36
104 0.32
105 0.26
106 0.19
107 0.16
108 0.13
109 0.1
110 0.08
111 0.07
112 0.05
113 0.05
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.09
125 0.1
126 0.1
127 0.1
128 0.12
129 0.12
130 0.12
131 0.12
132 0.13
133 0.14
134 0.22
135 0.28
136 0.27
137 0.32
138 0.38
139 0.42
140 0.5
141 0.58
142 0.61
143 0.66
144 0.75
145 0.79
146 0.8
147 0.83
148 0.82
149 0.82
150 0.78
151 0.78
152 0.78
153 0.78
154 0.77
155 0.72
156 0.69
157 0.67
158 0.65
159 0.57
160 0.49
161 0.4
162 0.35
163 0.36
164 0.34
165 0.28
166 0.26
167 0.3
168 0.29
169 0.29
170 0.32
171 0.33
172 0.34
173 0.37
174 0.42
175 0.39
176 0.4
177 0.41
178 0.39
179 0.39
180 0.38
181 0.35
182 0.28
183 0.35
184 0.33
185 0.36
186 0.41
187 0.38
188 0.35
189 0.35
190 0.35
191 0.27
192 0.28
193 0.25
194 0.19
195 0.18
196 0.16
197 0.16
198 0.21