Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NIQ4

Protein Details
Accession M7NIQ4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-48LDRKDVGKRSSDKKKKMRSRKETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
8-41KKLASKMPAGKSPLDRKDVGKRSSDKKKKMRSRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0006325  P:chromatin organization  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKVAEKKLASKMPAGKSPLDRKDVGKRSSDKKKKMRSRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERIASEASKLASYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.52
4 0.48
5 0.51
6 0.58
7 0.57
8 0.54
9 0.51
10 0.49
11 0.57
12 0.6
13 0.55
14 0.54
15 0.54
16 0.58
17 0.68
18 0.72
19 0.72
20 0.73
21 0.81
22 0.84
23 0.89
24 0.91
25 0.9
26 0.9
27 0.9
28 0.88
29 0.82
30 0.77
31 0.73
32 0.64
33 0.56
34 0.53
35 0.44
36 0.37
37 0.37
38 0.37
39 0.32
40 0.34
41 0.34
42 0.31
43 0.32
44 0.3
45 0.27
46 0.25
47 0.24
48 0.2
49 0.17
50 0.13
51 0.12
52 0.12
53 0.11
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.09
61 0.09
62 0.08
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.06
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.12
75 0.19
76 0.22
77 0.26
78 0.29
79 0.32
80 0.33
81 0.37
82 0.4
83 0.39
84 0.39
85 0.39
86 0.39
87 0.37
88 0.37
89 0.34
90 0.29
91 0.25
92 0.22
93 0.18
94 0.14
95 0.14
96 0.15
97 0.14
98 0.13
99 0.12
100 0.13
101 0.12
102 0.12
103 0.11
104 0.11
105 0.1
106 0.11
107 0.12
108 0.13
109 0.16
110 0.16
111 0.18
112 0.18
113 0.19