Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RXS3

Protein Details
Accession F4RXS3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-85ESLLNIPRKSRKRKLSSNIPLACKHydrophilic
NLS Segment(s)
PositionSequence
70-74KSRKR
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
KEGG mlr:MELLADRAFT_109831  -  
Amino Acid Sequences MSLSDSGYLLEIERQKSLKMAACRCSNCDPQGAAQLIRLLPQTKLSDLKSLMSSFPSQPEDESLLNIPRKSRKRKLSSNIPLACKSDDPIQMNIPMIDLTVSIIGNYELLFKKTYPTDPPYLPETLFSREDAWQIAKNYTSVSNGMFLRDILGGQTVPGLFDSIIASVNSWLRSDSYKQHQDEIEDIQISIDQEYLNTQLIEEEHEEQLRLKAVERDLKAQGIADQKRFRAEKTAETLRLKLQKQANKNKEIAHFSSTSGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.3
5 0.31
6 0.35
7 0.4
8 0.44
9 0.52
10 0.54
11 0.57
12 0.59
13 0.59
14 0.52
15 0.5
16 0.44
17 0.38
18 0.42
19 0.39
20 0.33
21 0.28
22 0.29
23 0.24
24 0.24
25 0.24
26 0.18
27 0.16
28 0.22
29 0.22
30 0.22
31 0.26
32 0.26
33 0.3
34 0.29
35 0.31
36 0.28
37 0.27
38 0.25
39 0.23
40 0.24
41 0.2
42 0.23
43 0.23
44 0.21
45 0.2
46 0.22
47 0.23
48 0.2
49 0.21
50 0.19
51 0.22
52 0.25
53 0.25
54 0.26
55 0.32
56 0.41
57 0.49
58 0.56
59 0.61
60 0.68
61 0.77
62 0.83
63 0.85
64 0.85
65 0.86
66 0.82
67 0.76
68 0.68
69 0.6
70 0.52
71 0.41
72 0.33
73 0.29
74 0.28
75 0.27
76 0.26
77 0.26
78 0.25
79 0.26
80 0.23
81 0.18
82 0.12
83 0.09
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.08
95 0.07
96 0.09
97 0.1
98 0.1
99 0.12
100 0.14
101 0.16
102 0.18
103 0.22
104 0.25
105 0.25
106 0.27
107 0.28
108 0.27
109 0.25
110 0.22
111 0.19
112 0.19
113 0.19
114 0.17
115 0.16
116 0.15
117 0.16
118 0.15
119 0.14
120 0.14
121 0.14
122 0.14
123 0.13
124 0.12
125 0.13
126 0.13
127 0.12
128 0.1
129 0.09
130 0.12
131 0.11
132 0.12
133 0.11
134 0.1
135 0.1
136 0.09
137 0.09
138 0.06
139 0.06
140 0.05
141 0.05
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.06
150 0.05
151 0.06
152 0.06
153 0.06
154 0.07
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.12
161 0.15
162 0.2
163 0.28
164 0.35
165 0.36
166 0.4
167 0.4
168 0.39
169 0.38
170 0.35
171 0.28
172 0.2
173 0.19
174 0.15
175 0.15
176 0.14
177 0.11
178 0.09
179 0.06
180 0.06
181 0.07
182 0.08
183 0.09
184 0.08
185 0.08
186 0.08
187 0.09
188 0.11
189 0.12
190 0.14
191 0.14
192 0.14
193 0.15
194 0.15
195 0.16
196 0.17
197 0.15
198 0.15
199 0.18
200 0.23
201 0.3
202 0.31
203 0.34
204 0.33
205 0.34
206 0.32
207 0.28
208 0.28
209 0.29
210 0.32
211 0.35
212 0.38
213 0.38
214 0.45
215 0.46
216 0.43
217 0.43
218 0.42
219 0.42
220 0.46
221 0.53
222 0.53
223 0.55
224 0.56
225 0.54
226 0.59
227 0.52
228 0.52
229 0.52
230 0.52
231 0.6
232 0.69
233 0.7
234 0.69
235 0.72
236 0.71
237 0.7
238 0.69
239 0.62
240 0.56
241 0.48
242 0.42