Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PIU2

Protein Details
Accession M7PIU2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSSKTRLVIVKKRRKRFTRHQSDKYKCISPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-21KKRRKRFTRH
33-47WRKPKGIDNRVRRRF
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSSKTRLVIVKKRRKRFTRHQSDKYKCISPSWRKPKGIDNRVRRRFKGQIPMPNIGYGSDKRTRYMRPNGYYTFLIRNESDVDLLLMHNDVYIGEIASNISSKKRVNIVEKARKLGVKLTNGLSRIRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.87
4 0.88
5 0.89
6 0.89
7 0.9
8 0.9
9 0.9
10 0.89
11 0.87
12 0.81
13 0.75
14 0.64
15 0.6
16 0.6
17 0.6
18 0.63
19 0.67
20 0.7
21 0.67
22 0.69
23 0.72
24 0.72
25 0.73
26 0.71
27 0.71
28 0.74
29 0.81
30 0.84
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.62
37 0.61
38 0.6
39 0.61
40 0.54
41 0.47
42 0.41
43 0.31
44 0.26
45 0.19
46 0.18
47 0.21
48 0.2
49 0.21
50 0.24
51 0.27
52 0.32
53 0.4
54 0.44
55 0.42
56 0.46
57 0.46
58 0.47
59 0.44
60 0.39
61 0.34
62 0.26
63 0.24
64 0.19
65 0.19
66 0.18
67 0.17
68 0.15
69 0.11
70 0.1
71 0.08
72 0.08
73 0.07
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.08
89 0.12
90 0.13
91 0.17
92 0.23
93 0.29
94 0.35
95 0.44
96 0.53
97 0.6
98 0.64
99 0.64
100 0.62
101 0.57
102 0.52
103 0.5
104 0.46
105 0.41
106 0.41
107 0.42
108 0.43
109 0.43
110 0.44
111 0.4