Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P2G9

Protein Details
Accession M7P2G9   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-106ESVRKEWVERRKQRGKGPPPKSKFKNESKSKKKBasic
NLS Segment(s)
PositionSequence
82-106ERRKQRGKGPPPKSKFKNESKSKKK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MEKLPSKKRLLELKSTACRIFGTIFNPKALRMGNRVLLRRFPGSTVSQYYSRFNLPPKVLIRAFPHLNLVDLDESVRKEWVERRKQRGKGPPPKSKFKNESKSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.6
4 0.5
5 0.45
6 0.37
7 0.32
8 0.25
9 0.23
10 0.27
11 0.28
12 0.3
13 0.3
14 0.28
15 0.29
16 0.28
17 0.26
18 0.21
19 0.24
20 0.27
21 0.32
22 0.36
23 0.34
24 0.35
25 0.35
26 0.34
27 0.3
28 0.25
29 0.24
30 0.22
31 0.23
32 0.24
33 0.23
34 0.24
35 0.25
36 0.25
37 0.23
38 0.23
39 0.21
40 0.2
41 0.23
42 0.21
43 0.24
44 0.24
45 0.28
46 0.27
47 0.29
48 0.3
49 0.3
50 0.31
51 0.25
52 0.27
53 0.22
54 0.22
55 0.19
56 0.17
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.09
65 0.11
66 0.19
67 0.28
68 0.38
69 0.46
70 0.56
71 0.65
72 0.72
73 0.79
74 0.83
75 0.83
76 0.83
77 0.84
78 0.85
79 0.83
80 0.87
81 0.84
82 0.84
83 0.82
84 0.82
85 0.83
86 0.83