Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P5F6

Protein Details
Accession M7P5F6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-54SLPSYVHPKRIKQKQIPERTGLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000597  Ribosomal_L3  
IPR019927  Ribosomal_L3_bac/org-type  
IPR019926  Ribosomal_L3_CS  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
PROSITE View protein in PROSITE  
PS00474  RIBOSOMAL_L3  
Amino Acid Sequences MRSLLFRCYRSFFSSSKRSILSRKPLKSSQELSLPSYVHPKRIKQKQIPERTGLLARKRGMTAVWTQDGERIPVTVLQVDRLQVIEIRTKKKNGYNAVQVGMGSRNPKNISKAMLGHFAKAKVPPKSKLVEFRTKEPVESLVPGTQLFVNHFQEGTFVDIRGKSIGKGFSGVMKRWKFHGLPASHGVSISHRSSGSMGQSQDPGRVLPGKKMAGRMGGKNVTIQNVPIIKIDHENGLILVKGSVPGPDKGYVTIKDTIKRAPPNLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.51
4 0.5
5 0.48
6 0.52
7 0.58
8 0.6
9 0.61
10 0.64
11 0.66
12 0.69
13 0.72
14 0.71
15 0.66
16 0.6
17 0.58
18 0.54
19 0.5
20 0.47
21 0.41
22 0.34
23 0.4
24 0.36
25 0.36
26 0.39
27 0.44
28 0.51
29 0.6
30 0.7
31 0.69
32 0.79
33 0.81
34 0.87
35 0.84
36 0.78
37 0.71
38 0.64
39 0.61
40 0.57
41 0.52
42 0.48
43 0.44
44 0.42
45 0.4
46 0.37
47 0.3
48 0.27
49 0.26
50 0.25
51 0.26
52 0.24
53 0.24
54 0.27
55 0.27
56 0.25
57 0.2
58 0.15
59 0.12
60 0.13
61 0.14
62 0.13
63 0.12
64 0.13
65 0.13
66 0.14
67 0.13
68 0.12
69 0.12
70 0.1
71 0.12
72 0.17
73 0.21
74 0.27
75 0.3
76 0.33
77 0.37
78 0.4
79 0.46
80 0.46
81 0.47
82 0.49
83 0.48
84 0.46
85 0.42
86 0.37
87 0.3
88 0.24
89 0.2
90 0.15
91 0.13
92 0.16
93 0.18
94 0.21
95 0.23
96 0.24
97 0.25
98 0.25
99 0.28
100 0.25
101 0.32
102 0.3
103 0.28
104 0.28
105 0.25
106 0.24
107 0.24
108 0.28
109 0.27
110 0.31
111 0.32
112 0.34
113 0.37
114 0.38
115 0.43
116 0.44
117 0.47
118 0.45
119 0.46
120 0.51
121 0.47
122 0.45
123 0.36
124 0.32
125 0.23
126 0.22
127 0.19
128 0.12
129 0.12
130 0.12
131 0.12
132 0.1
133 0.09
134 0.1
135 0.12
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.12
142 0.14
143 0.11
144 0.09
145 0.1
146 0.11
147 0.11
148 0.12
149 0.12
150 0.09
151 0.12
152 0.13
153 0.12
154 0.13
155 0.13
156 0.18
157 0.21
158 0.22
159 0.28
160 0.29
161 0.3
162 0.31
163 0.36
164 0.31
165 0.32
166 0.39
167 0.31
168 0.33
169 0.37
170 0.37
171 0.32
172 0.31
173 0.27
174 0.2
175 0.23
176 0.19
177 0.17
178 0.14
179 0.15
180 0.16
181 0.18
182 0.19
183 0.19
184 0.2
185 0.19
186 0.23
187 0.23
188 0.24
189 0.23
190 0.19
191 0.17
192 0.22
193 0.22
194 0.23
195 0.28
196 0.31
197 0.32
198 0.36
199 0.35
200 0.37
201 0.4
202 0.38
203 0.4
204 0.39
205 0.37
206 0.37
207 0.37
208 0.32
209 0.29
210 0.25
211 0.24
212 0.23
213 0.23
214 0.21
215 0.21
216 0.19
217 0.22
218 0.23
219 0.2
220 0.18
221 0.18
222 0.16
223 0.15
224 0.14
225 0.11
226 0.1
227 0.08
228 0.08
229 0.08
230 0.11
231 0.13
232 0.15
233 0.18
234 0.2
235 0.21
236 0.24
237 0.29
238 0.27
239 0.29
240 0.34
241 0.35
242 0.38
243 0.39
244 0.42
245 0.46
246 0.51
247 0.51