Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NWP9

Protein Details
Accession M7NWP9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-34PKLRRTFCEAKQCRKHTQHKVTQYKKGKDSHydrophilic
71-93KLECTVCKRKKQIPLKRCKHFELHydrophilic
NLS Segment(s)
PositionSequence
40-66KRRYDRKQRGYGGQTKQIFRKKAKTTK
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKLRRTFCEAKQCRKHTQHKVTQYKKGKDSLYAQGKRRYDRKQRGYGGQTKQIFRKKAKTTKKVVLKLECTVCKRKKQIPLKRCKHFELGGDKKTKGAALMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.77
4 0.79
5 0.81
6 0.83
7 0.83
8 0.85
9 0.84
10 0.84
11 0.89
12 0.86
13 0.86
14 0.86
15 0.82
16 0.76
17 0.72
18 0.62
19 0.56
20 0.54
21 0.53
22 0.54
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.6
30 0.61
31 0.65
32 0.68
33 0.7
34 0.71
35 0.73
36 0.72
37 0.71
38 0.64
39 0.61
40 0.55
41 0.48
42 0.51
43 0.49
44 0.48
45 0.43
46 0.49
47 0.5
48 0.57
49 0.65
50 0.67
51 0.68
52 0.72
53 0.78
54 0.76
55 0.74
56 0.71
57 0.64
58 0.61
59 0.6
60 0.56
61 0.52
62 0.54
63 0.53
64 0.55
65 0.59
66 0.61
67 0.65
68 0.7
69 0.76
70 0.77
71 0.82
72 0.84
73 0.87
74 0.85
75 0.8
76 0.76
77 0.69
78 0.66
79 0.65
80 0.64
81 0.62
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42