Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PIN9

Protein Details
Accession A0A1D8PIN9   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
227-250EQARKLRFAKKSIRDGNRNNEKDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR024253  Phosducin_thioredoxin-like_dom  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003779  F:actin binding  
GO:0031683  F:G-protein beta/gamma-subunit complex binding  
GO:0030036  P:actin cytoskeleton organization  
GO:1903645  P:negative regulation of chaperone-mediated protein folding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006457  P:protein folding  
GO:0051726  P:regulation of cell cycle  
KEGG cal:CAALFM_C210120WA  -  
Pfam View protein in Pfam  
PF02114  Phosducin  
CDD cd02988  Phd_like_VIAF  
Amino Acid Sequences MNNDPKFQVQVDPNEDTEWNDILRQHGIIPEKPPSPSVELETALEEAIVKQYDNRLENKDLDELDELEDEEDEDFLNHYKQKRMAEIKKLSEKKKFGHVLPISKNEYENEVTKASKESYVLVHLSLQSSLQSRLLSSILIDLASKFPELKICDIPAQRCIENYPESNCPTLIIYHDTNVVKQFITLTQLGGNATTLKDVETALADLNVIGFHDKRLIINNDEDEDLEQARKLRFAKKSIRDGNRNNEKDKDEDDDDDEDDDDFYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.34
4 0.31
5 0.24
6 0.19
7 0.18
8 0.17
9 0.18
10 0.19
11 0.17
12 0.15
13 0.19
14 0.23
15 0.24
16 0.27
17 0.3
18 0.31
19 0.32
20 0.32
21 0.31
22 0.31
23 0.3
24 0.3
25 0.27
26 0.26
27 0.25
28 0.25
29 0.22
30 0.17
31 0.15
32 0.11
33 0.08
34 0.1
35 0.09
36 0.08
37 0.09
38 0.13
39 0.19
40 0.22
41 0.26
42 0.28
43 0.31
44 0.34
45 0.35
46 0.34
47 0.28
48 0.27
49 0.25
50 0.2
51 0.18
52 0.16
53 0.14
54 0.1
55 0.1
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.06
63 0.08
64 0.12
65 0.14
66 0.18
67 0.23
68 0.25
69 0.33
70 0.42
71 0.47
72 0.54
73 0.59
74 0.62
75 0.67
76 0.72
77 0.69
78 0.68
79 0.65
80 0.58
81 0.6
82 0.57
83 0.48
84 0.51
85 0.5
86 0.5
87 0.5
88 0.54
89 0.47
90 0.43
91 0.43
92 0.33
93 0.32
94 0.26
95 0.22
96 0.19
97 0.17
98 0.17
99 0.16
100 0.18
101 0.15
102 0.14
103 0.13
104 0.11
105 0.11
106 0.13
107 0.13
108 0.11
109 0.11
110 0.1
111 0.1
112 0.09
113 0.08
114 0.07
115 0.08
116 0.09
117 0.09
118 0.09
119 0.08
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.05
133 0.05
134 0.09
135 0.11
136 0.13
137 0.14
138 0.16
139 0.2
140 0.23
141 0.24
142 0.25
143 0.26
144 0.24
145 0.22
146 0.22
147 0.21
148 0.21
149 0.22
150 0.21
151 0.22
152 0.24
153 0.24
154 0.23
155 0.19
156 0.17
157 0.16
158 0.14
159 0.14
160 0.13
161 0.13
162 0.18
163 0.18
164 0.18
165 0.19
166 0.19
167 0.14
168 0.14
169 0.14
170 0.09
171 0.13
172 0.12
173 0.11
174 0.11
175 0.12
176 0.12
177 0.11
178 0.11
179 0.08
180 0.08
181 0.08
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.08
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.05
195 0.05
196 0.06
197 0.06
198 0.07
199 0.1
200 0.11
201 0.12
202 0.19
203 0.22
204 0.24
205 0.28
206 0.3
207 0.29
208 0.28
209 0.28
210 0.22
211 0.2
212 0.18
213 0.14
214 0.13
215 0.15
216 0.15
217 0.2
218 0.22
219 0.29
220 0.34
221 0.42
222 0.52
223 0.57
224 0.67
225 0.72
226 0.79
227 0.81
228 0.82
229 0.85
230 0.86
231 0.82
232 0.76
233 0.72
234 0.65
235 0.6
236 0.55
237 0.51
238 0.44
239 0.41
240 0.4
241 0.36
242 0.34
243 0.31
244 0.28
245 0.21