Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NSG7

Protein Details
Accession M7NSG7   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-51LDEWRRKKEERKPLWTLKQKKEESBasic
145-164KENMSPMKSKWLSRRKKYRLHydrophilic
NLS Segment(s)
PositionSequence
33-38RKKEER
158-161RRKK
Subcellular Location(s) nucl 22, mito_nucl 13.333, cyto_nucl 11.833
Family & Domain DBs
Amino Acid Sequences MTSKEQIKTQNNVSEELKGNNLFIEENLDEWRRKKEERKPLWTLKQKKEESTYVYVPSVKVSLEPSIFSSIYATDGFITPCRQKEILILKDGKNKDKIKMQPQSAPAKINKSFHEKFDIYYDEETYIEIPETKTNIEIFSLEMNKENMSPMKSKWLSRRKKYRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.37
4 0.34
5 0.27
6 0.26
7 0.22
8 0.21
9 0.16
10 0.13
11 0.17
12 0.12
13 0.13
14 0.17
15 0.19
16 0.21
17 0.23
18 0.3
19 0.29
20 0.35
21 0.43
22 0.49
23 0.58
24 0.65
25 0.72
26 0.74
27 0.79
28 0.84
29 0.84
30 0.85
31 0.83
32 0.83
33 0.77
34 0.73
35 0.68
36 0.62
37 0.57
38 0.53
39 0.46
40 0.37
41 0.36
42 0.32
43 0.26
44 0.23
45 0.18
46 0.12
47 0.11
48 0.1
49 0.11
50 0.11
51 0.11
52 0.12
53 0.14
54 0.14
55 0.13
56 0.12
57 0.1
58 0.11
59 0.1
60 0.09
61 0.06
62 0.07
63 0.07
64 0.08
65 0.1
66 0.11
67 0.12
68 0.14
69 0.14
70 0.14
71 0.2
72 0.27
73 0.27
74 0.3
75 0.33
76 0.32
77 0.39
78 0.41
79 0.39
80 0.39
81 0.38
82 0.37
83 0.41
84 0.46
85 0.48
86 0.53
87 0.53
88 0.51
89 0.55
90 0.59
91 0.53
92 0.51
93 0.44
94 0.43
95 0.43
96 0.41
97 0.38
98 0.4
99 0.4
100 0.37
101 0.43
102 0.36
103 0.34
104 0.35
105 0.34
106 0.28
107 0.27
108 0.26
109 0.19
110 0.18
111 0.18
112 0.13
113 0.11
114 0.09
115 0.09
116 0.09
117 0.11
118 0.12
119 0.12
120 0.14
121 0.14
122 0.14
123 0.13
124 0.13
125 0.11
126 0.15
127 0.17
128 0.16
129 0.18
130 0.18
131 0.18
132 0.18
133 0.2
134 0.19
135 0.2
136 0.22
137 0.22
138 0.31
139 0.34
140 0.41
141 0.48
142 0.55
143 0.63
144 0.71