Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NR07

Protein Details
Accession M7NR07    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
207-236MFDYYFKLSKWNKKRKLNKKAKQEISEKTMHydrophilic
NLS Segment(s)
PositionSequence
216-228KWNKKRKLNKKAK
Subcellular Location(s) plas 16, mito 5, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006603  PQ-loop_rpt  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04193  PQ-loop  
Amino Acid Sequences MFHNPVIAAILGTIGTILWCIQLIPQIVVNYLRHSTQGFQPLMLLLWSIGAVIMGIYNISRNLNIPLQLQPQLFLVLCFITWGQCLYYEKKWSIYKCITIFSSGGCISGFIEAGFVFIARSLIRQNIKWPIISIGIISSIFICIGLFPPYYDIYIHKCVRGISFIFLLIDMGGALFSFLSLLFELKFDILAAISYSFVFFLEMGIIMFDYYFKLSKWNKKRKLNKKAKQEISEKTMDTIDINVEASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.1
10 0.12
11 0.12
12 0.16
13 0.16
14 0.17
15 0.21
16 0.21
17 0.2
18 0.2
19 0.19
20 0.18
21 0.19
22 0.2
23 0.22
24 0.3
25 0.27
26 0.25
27 0.25
28 0.24
29 0.23
30 0.2
31 0.15
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.05
46 0.06
47 0.06
48 0.07
49 0.11
50 0.13
51 0.14
52 0.16
53 0.18
54 0.21
55 0.25
56 0.24
57 0.21
58 0.2
59 0.2
60 0.18
61 0.14
62 0.12
63 0.07
64 0.07
65 0.07
66 0.06
67 0.05
68 0.06
69 0.06
70 0.06
71 0.08
72 0.11
73 0.15
74 0.19
75 0.23
76 0.23
77 0.29
78 0.33
79 0.32
80 0.37
81 0.36
82 0.38
83 0.35
84 0.36
85 0.31
86 0.28
87 0.27
88 0.19
89 0.19
90 0.13
91 0.12
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.04
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.04
106 0.04
107 0.05
108 0.05
109 0.09
110 0.11
111 0.12
112 0.15
113 0.21
114 0.22
115 0.22
116 0.21
117 0.19
118 0.18
119 0.18
120 0.14
121 0.08
122 0.08
123 0.07
124 0.07
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.04
132 0.06
133 0.06
134 0.06
135 0.08
136 0.09
137 0.09
138 0.1
139 0.11
140 0.14
141 0.22
142 0.23
143 0.21
144 0.22
145 0.22
146 0.23
147 0.24
148 0.2
149 0.15
150 0.14
151 0.14
152 0.13
153 0.12
154 0.11
155 0.08
156 0.06
157 0.04
158 0.03
159 0.03
160 0.02
161 0.03
162 0.02
163 0.02
164 0.02
165 0.02
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.07
198 0.08
199 0.08
200 0.17
201 0.25
202 0.36
203 0.47
204 0.57
205 0.65
206 0.75
207 0.87
208 0.89
209 0.92
210 0.93
211 0.92
212 0.92
213 0.93
214 0.92
215 0.9
216 0.87
217 0.83
218 0.78
219 0.74
220 0.64
221 0.55
222 0.46
223 0.37
224 0.3
225 0.23
226 0.18
227 0.14