Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NNA5

Protein Details
Accession M7NNA5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-128LEEKVDRTSRQQRKQRKNRSKKFRGVAKKAAMTHydrophilic
NLS Segment(s)
PositionSequence
105-133RQQRKQRKNRSKKFRGVAKKAAMTASTKK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSITIRTRKFLTNRLLCRKQMVVDVLHPNRPNVSKNDLRERLAYMYKTDKNTVQVFGLRTQFGGGKSTGFALIYDSFELMKRFEPKYRLVRIGLEEKVDRTSRQQRKQRKNRSKKFRGVAKKAAMTASTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.7
4 0.74
5 0.67
6 0.67
7 0.61
8 0.52
9 0.48
10 0.41
11 0.33
12 0.33
13 0.41
14 0.39
15 0.42
16 0.41
17 0.36
18 0.37
19 0.37
20 0.35
21 0.29
22 0.34
23 0.35
24 0.4
25 0.5
26 0.5
27 0.49
28 0.47
29 0.45
30 0.41
31 0.39
32 0.34
33 0.26
34 0.29
35 0.31
36 0.32
37 0.31
38 0.29
39 0.3
40 0.31
41 0.29
42 0.23
43 0.22
44 0.21
45 0.22
46 0.22
47 0.17
48 0.16
49 0.15
50 0.16
51 0.13
52 0.13
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.08
69 0.11
70 0.15
71 0.17
72 0.21
73 0.24
74 0.3
75 0.38
76 0.43
77 0.43
78 0.41
79 0.41
80 0.41
81 0.44
82 0.38
83 0.33
84 0.28
85 0.25
86 0.28
87 0.27
88 0.24
89 0.26
90 0.35
91 0.42
92 0.52
93 0.6
94 0.67
95 0.77
96 0.87
97 0.91
98 0.91
99 0.93
100 0.93
101 0.95
102 0.95
103 0.94
104 0.92
105 0.91
106 0.91
107 0.89
108 0.87
109 0.84
110 0.79
111 0.7
112 0.63
113 0.54