Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SBT7

Protein Details
Accession F4SBT7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
164-190TEKIKELSRSTRKSKRVTSQTHDQVSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_114003  -  
Amino Acid Sequences MAETEPPQEDLPMESNNQTDTTTNPATTSPAESVAKPSGTRGNRKEQGNRAKIAVSSQKPDDPLSQIPPNSKDKEAEGQDPKASSPEAEATPMQGSSSNIDKVHTANTNQPVKESIPTRDTIEEINHETEEQSLSRADSPLTSQSETQSPRTTRAHKVSEVTRTEKIKELSRSTRKSKRVTSQTHDQVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.2
5 0.18
6 0.15
7 0.15
8 0.2
9 0.2
10 0.2
11 0.19
12 0.19
13 0.2
14 0.21
15 0.22
16 0.16
17 0.19
18 0.2
19 0.2
20 0.24
21 0.24
22 0.24
23 0.21
24 0.23
25 0.27
26 0.31
27 0.4
28 0.41
29 0.48
30 0.53
31 0.59
32 0.65
33 0.66
34 0.71
35 0.68
36 0.64
37 0.55
38 0.5
39 0.44
40 0.41
41 0.4
42 0.32
43 0.3
44 0.3
45 0.31
46 0.31
47 0.33
48 0.29
49 0.25
50 0.25
51 0.26
52 0.28
53 0.27
54 0.29
55 0.32
56 0.36
57 0.34
58 0.33
59 0.29
60 0.27
61 0.33
62 0.32
63 0.35
64 0.33
65 0.32
66 0.32
67 0.31
68 0.28
69 0.22
70 0.2
71 0.12
72 0.1
73 0.1
74 0.09
75 0.11
76 0.1
77 0.1
78 0.11
79 0.11
80 0.09
81 0.08
82 0.08
83 0.08
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.12
90 0.14
91 0.15
92 0.14
93 0.17
94 0.25
95 0.29
96 0.28
97 0.28
98 0.27
99 0.26
100 0.29
101 0.26
102 0.22
103 0.2
104 0.22
105 0.23
106 0.22
107 0.22
108 0.19
109 0.18
110 0.17
111 0.18
112 0.18
113 0.16
114 0.15
115 0.14
116 0.14
117 0.13
118 0.11
119 0.09
120 0.08
121 0.09
122 0.1
123 0.1
124 0.1
125 0.09
126 0.11
127 0.16
128 0.19
129 0.19
130 0.18
131 0.2
132 0.26
133 0.29
134 0.3
135 0.33
136 0.31
137 0.36
138 0.42
139 0.45
140 0.48
141 0.53
142 0.55
143 0.5
144 0.54
145 0.54
146 0.56
147 0.56
148 0.52
149 0.51
150 0.48
151 0.47
152 0.48
153 0.46
154 0.45
155 0.47
156 0.51
157 0.55
158 0.62
159 0.68
160 0.71
161 0.77
162 0.78
163 0.79
164 0.8
165 0.81
166 0.81
167 0.82
168 0.8
169 0.82
170 0.83