Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NP72

Protein Details
Accession M7NP72    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-99DSKISDEKIEKKKKFKKDNKEKIKSNNFLRSRBasic
NLS Segment(s)
PositionSequence
76-92IEKKKKFKKDNKEKIKS
Subcellular Location(s) mito 14.5, mito_nucl 11.5, nucl 7.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MDLHNKIASKLLIKYKLVIKNISRNFSFKSLAPEGTILKGINIYKKGMDPMALKESEYPDWLWKILDDSKISDEKIEKKKKFKKDNKEKIKSNNFLRSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.48
4 0.48
5 0.49
6 0.45
7 0.5
8 0.55
9 0.56
10 0.49
11 0.45
12 0.45
13 0.42
14 0.39
15 0.31
16 0.32
17 0.3
18 0.29
19 0.26
20 0.25
21 0.22
22 0.21
23 0.2
24 0.13
25 0.1
26 0.12
27 0.12
28 0.14
29 0.15
30 0.14
31 0.14
32 0.15
33 0.16
34 0.13
35 0.15
36 0.13
37 0.14
38 0.17
39 0.17
40 0.16
41 0.16
42 0.18
43 0.16
44 0.16
45 0.14
46 0.12
47 0.13
48 0.14
49 0.12
50 0.1
51 0.13
52 0.15
53 0.17
54 0.16
55 0.18
56 0.21
57 0.23
58 0.23
59 0.22
60 0.23
61 0.28
62 0.38
63 0.46
64 0.49
65 0.58
66 0.67
67 0.76
68 0.83
69 0.85
70 0.86
71 0.87
72 0.92
73 0.93
74 0.94
75 0.91
76 0.91
77 0.91
78 0.88
79 0.86
80 0.85