Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P963

Protein Details
Accession M7P963    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-119PATTKFRKLLSKERNPPIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR032413  Arm_3  
IPR000225  Armadillo  
IPR002652  Importin-a_IBB  
IPR036975  Importin-a_IBB_sf  
IPR024931  Importin_alpha  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0061608  F:nuclear import signal receptor activity  
GO:0006606  P:protein import into nucleus  
Pfam View protein in Pfam  
PF00514  Arm  
PF16186  Arm_3  
PF01749  IBB  
PROSITE View protein in PROSITE  
PS50176  ARM_REPEAT  
PS51214  IBB  
Amino Acid Sequences MSNLDTSRFVPEYRRNNFKSKNIFRIDELRRRREEQRLEIRKQIKEESLAKRRNLNLPLGLETTESDDEESALHLENQLNNELPLMIAGVFSDNIEEQIPATTKFRKLLSKERNPPIEKVIECGVVSRFVEFLKSPHTLVQFEAAWALTNIASGSSSQTQVVIEAGAVPIFVELLSSPEADVREQAVWALGNIAGDSPECRDFVLRAGALKPLLSLLTESRKLSMLRNATWTLSNFCRGKNPQPDWNTISPALPVLAKLIFSLDDEVLIDSSWAISYLSDGSNDKIQAIIDAGIPRRLVELLMHPSTSVQTPALRSVGNIVTGDDIQTQVIINCGALQALLSLLSSPKDGIKKEACWTISNITAGNCTQIQAVIDANIIPPLINLLANADFKTKKEACWALSNATSGGLSRPDQIRYLVSQGCIKPLCDLLTCLDNKIIQVALDGLENILKIGELDKENKGGLNRFALYIEEAGGMEKIHNLQQNSNQEIYLKSYNIIEKYFNDEDDIDSGLAPQVEGQTFSFGNIASNAEFPATQQFDFSNINTNGDTTMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.68
4 0.75
5 0.76
6 0.77
7 0.76
8 0.79
9 0.76
10 0.74
11 0.68
12 0.7
13 0.7
14 0.69
15 0.7
16 0.69
17 0.68
18 0.7
19 0.73
20 0.73
21 0.73
22 0.73
23 0.75
24 0.76
25 0.75
26 0.79
27 0.79
28 0.73
29 0.69
30 0.64
31 0.57
32 0.55
33 0.58
34 0.59
35 0.62
36 0.65
37 0.63
38 0.65
39 0.66
40 0.67
41 0.62
42 0.57
43 0.52
44 0.48
45 0.48
46 0.42
47 0.37
48 0.3
49 0.26
50 0.25
51 0.2
52 0.17
53 0.14
54 0.13
55 0.13
56 0.12
57 0.12
58 0.09
59 0.09
60 0.09
61 0.1
62 0.13
63 0.15
64 0.17
65 0.18
66 0.18
67 0.17
68 0.17
69 0.15
70 0.12
71 0.09
72 0.08
73 0.06
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.06
81 0.07
82 0.08
83 0.08
84 0.07
85 0.1
86 0.12
87 0.12
88 0.16
89 0.2
90 0.22
91 0.26
92 0.3
93 0.34
94 0.39
95 0.49
96 0.56
97 0.62
98 0.69
99 0.75
100 0.8
101 0.75
102 0.72
103 0.67
104 0.63
105 0.52
106 0.45
107 0.39
108 0.31
109 0.28
110 0.27
111 0.22
112 0.18
113 0.18
114 0.15
115 0.13
116 0.11
117 0.14
118 0.12
119 0.13
120 0.15
121 0.16
122 0.17
123 0.2
124 0.23
125 0.21
126 0.21
127 0.24
128 0.19
129 0.17
130 0.17
131 0.13
132 0.11
133 0.1
134 0.1
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.05
141 0.09
142 0.1
143 0.11
144 0.1
145 0.11
146 0.11
147 0.11
148 0.11
149 0.07
150 0.06
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.05
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.09
168 0.1
169 0.1
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.09
190 0.11
191 0.15
192 0.13
193 0.13
194 0.14
195 0.15
196 0.14
197 0.14
198 0.12
199 0.08
200 0.08
201 0.07
202 0.07
203 0.08
204 0.13
205 0.15
206 0.16
207 0.16
208 0.19
209 0.19
210 0.21
211 0.24
212 0.23
213 0.22
214 0.27
215 0.27
216 0.25
217 0.26
218 0.25
219 0.22
220 0.19
221 0.24
222 0.21
223 0.2
224 0.27
225 0.28
226 0.36
227 0.42
228 0.45
229 0.47
230 0.49
231 0.54
232 0.52
233 0.5
234 0.45
235 0.35
236 0.32
237 0.24
238 0.2
239 0.16
240 0.1
241 0.08
242 0.07
243 0.06
244 0.06
245 0.06
246 0.06
247 0.05
248 0.06
249 0.07
250 0.06
251 0.06
252 0.06
253 0.06
254 0.06
255 0.05
256 0.05
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.05
265 0.05
266 0.06
267 0.07
268 0.08
269 0.1
270 0.1
271 0.09
272 0.08
273 0.08
274 0.07
275 0.07
276 0.07
277 0.06
278 0.08
279 0.09
280 0.1
281 0.1
282 0.1
283 0.1
284 0.09
285 0.08
286 0.07
287 0.11
288 0.14
289 0.15
290 0.15
291 0.14
292 0.15
293 0.15
294 0.15
295 0.12
296 0.07
297 0.08
298 0.09
299 0.11
300 0.12
301 0.11
302 0.11
303 0.13
304 0.13
305 0.12
306 0.11
307 0.1
308 0.1
309 0.1
310 0.11
311 0.07
312 0.07
313 0.06
314 0.06
315 0.06
316 0.05
317 0.05
318 0.05
319 0.04
320 0.04
321 0.04
322 0.04
323 0.04
324 0.04
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.04
331 0.04
332 0.05
333 0.05
334 0.09
335 0.12
336 0.13
337 0.19
338 0.22
339 0.25
340 0.28
341 0.33
342 0.31
343 0.29
344 0.31
345 0.27
346 0.26
347 0.24
348 0.21
349 0.16
350 0.16
351 0.15
352 0.14
353 0.12
354 0.1
355 0.09
356 0.09
357 0.09
358 0.08
359 0.08
360 0.07
361 0.07
362 0.07
363 0.07
364 0.06
365 0.06
366 0.05
367 0.04
368 0.05
369 0.05
370 0.05
371 0.05
372 0.07
373 0.09
374 0.1
375 0.11
376 0.14
377 0.14
378 0.15
379 0.24
380 0.22
381 0.21
382 0.28
383 0.31
384 0.3
385 0.37
386 0.39
387 0.33
388 0.34
389 0.34
390 0.26
391 0.23
392 0.2
393 0.13
394 0.12
395 0.11
396 0.11
397 0.14
398 0.17
399 0.18
400 0.19
401 0.2
402 0.21
403 0.21
404 0.25
405 0.23
406 0.22
407 0.26
408 0.25
409 0.3
410 0.28
411 0.27
412 0.23
413 0.23
414 0.24
415 0.19
416 0.2
417 0.16
418 0.21
419 0.22
420 0.21
421 0.21
422 0.19
423 0.18
424 0.18
425 0.16
426 0.1
427 0.1
428 0.09
429 0.08
430 0.08
431 0.08
432 0.07
433 0.07
434 0.07
435 0.06
436 0.05
437 0.04
438 0.04
439 0.06
440 0.1
441 0.12
442 0.15
443 0.17
444 0.19
445 0.2
446 0.22
447 0.24
448 0.24
449 0.24
450 0.26
451 0.25
452 0.24
453 0.24
454 0.23
455 0.21
456 0.18
457 0.16
458 0.11
459 0.1
460 0.1
461 0.1
462 0.09
463 0.08
464 0.09
465 0.09
466 0.13
467 0.18
468 0.19
469 0.23
470 0.31
471 0.39
472 0.42
473 0.41
474 0.37
475 0.34
476 0.34
477 0.35
478 0.31
479 0.24
480 0.2
481 0.23
482 0.27
483 0.29
484 0.29
485 0.26
486 0.24
487 0.32
488 0.33
489 0.29
490 0.27
491 0.25
492 0.25
493 0.24
494 0.24
495 0.15
496 0.13
497 0.14
498 0.12
499 0.12
500 0.1
501 0.09
502 0.11
503 0.11
504 0.13
505 0.13
506 0.15
507 0.15
508 0.16
509 0.16
510 0.13
511 0.14
512 0.13
513 0.14
514 0.12
515 0.13
516 0.13
517 0.13
518 0.12
519 0.12
520 0.19
521 0.2
522 0.19
523 0.2
524 0.2
525 0.23
526 0.26
527 0.26
528 0.27
529 0.25
530 0.28
531 0.27
532 0.27