Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PDD5

Protein Details
Accession M7PDD5   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIRRPKIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIRRPKIGCFLSLKYVDPKFRLNRKYAVRGTCRALRKTHVVCTAMEHTFSRLLKDIAVQKRVSCSTILHKYCCVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.82
5 0.81
6 0.83
7 0.86
8 0.85
9 0.79
10 0.73
11 0.68
12 0.66
13 0.57
14 0.5
15 0.44
16 0.37
17 0.38
18 0.36
19 0.33
20 0.31
21 0.33
22 0.32
23 0.29
24 0.34
25 0.36
26 0.43
27 0.46
28 0.43
29 0.47
30 0.5
31 0.56
32 0.55
33 0.54
34 0.5
35 0.48
36 0.49
37 0.48
38 0.48
39 0.42
40 0.39
41 0.36
42 0.4
43 0.4
44 0.41
45 0.4
46 0.36
47 0.33
48 0.36
49 0.37
50 0.29
51 0.28
52 0.22
53 0.19
54 0.22
55 0.22
56 0.2
57 0.17
58 0.17
59 0.16
60 0.21
61 0.28
62 0.3
63 0.35
64 0.34
65 0.33
66 0.39
67 0.4
68 0.36
69 0.29
70 0.26
71 0.3
72 0.4
73 0.43
74 0.4