Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NRI7

Protein Details
Accession M7NRI7    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-115IFYESWKTRKKEQTRRDKVADDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010754  OPA3-like  
Pfam View protein in Pfam  
PF07047  OPA3  
Amino Acid Sequences MSLALKIGFLVIKTLSKPIATNLKRQAKQYPYFRKICVDLAQVMHRTESHMKANLLGKRKKTKHTQCLNEENAIERGADFLSESFLFLTAGSLIFYESWKTRKKEQTRRDKVADDIEELQKQLASLKKYIEETVLSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.17
5 0.21
6 0.3
7 0.3
8 0.37
9 0.45
10 0.54
11 0.56
12 0.58
13 0.62
14 0.59
15 0.66
16 0.68
17 0.69
18 0.66
19 0.67
20 0.65
21 0.6
22 0.54
23 0.5
24 0.43
25 0.35
26 0.3
27 0.28
28 0.3
29 0.29
30 0.26
31 0.23
32 0.19
33 0.2
34 0.21
35 0.22
36 0.22
37 0.23
38 0.23
39 0.26
40 0.32
41 0.32
42 0.37
43 0.38
44 0.41
45 0.48
46 0.52
47 0.55
48 0.6
49 0.66
50 0.68
51 0.74
52 0.75
53 0.72
54 0.76
55 0.71
56 0.62
57 0.52
58 0.43
59 0.34
60 0.26
61 0.19
62 0.11
63 0.09
64 0.07
65 0.07
66 0.05
67 0.04
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.07
84 0.09
85 0.15
86 0.22
87 0.26
88 0.34
89 0.44
90 0.55
91 0.64
92 0.72
93 0.78
94 0.81
95 0.86
96 0.83
97 0.76
98 0.69
99 0.66
100 0.58
101 0.51
102 0.45
103 0.41
104 0.36
105 0.33
106 0.3
107 0.21
108 0.19
109 0.2
110 0.21
111 0.2
112 0.22
113 0.24
114 0.28
115 0.3
116 0.32
117 0.29
118 0.27