Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PBN4

Protein Details
Accession M7PBN4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPSLKTGKKLKPLQRKLVDSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPSLKTGKKLKPLQRKLVDSFPSLKVSKVSSKQLKKTDDNIVQKKNILKSEIQTNEKVINLYRSEEDFFPSVVEKSNYVNIDEQTHIDEALNMFDLTYKYGPFVGLSRLDRWNRAEKLGLCPPIEIKKLLLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.78
4 0.77
5 0.71
6 0.63
7 0.58
8 0.5
9 0.47
10 0.4
11 0.36
12 0.29
13 0.29
14 0.34
15 0.34
16 0.41
17 0.45
18 0.53
19 0.6
20 0.66
21 0.69
22 0.66
23 0.66
24 0.65
25 0.64
26 0.66
27 0.66
28 0.62
29 0.57
30 0.55
31 0.54
32 0.49
33 0.43
34 0.36
35 0.29
36 0.27
37 0.35
38 0.38
39 0.37
40 0.33
41 0.32
42 0.31
43 0.29
44 0.27
45 0.19
46 0.16
47 0.14
48 0.14
49 0.14
50 0.14
51 0.15
52 0.14
53 0.15
54 0.12
55 0.12
56 0.1
57 0.1
58 0.09
59 0.09
60 0.1
61 0.09
62 0.1
63 0.14
64 0.14
65 0.15
66 0.16
67 0.15
68 0.17
69 0.17
70 0.16
71 0.14
72 0.13
73 0.12
74 0.1
75 0.1
76 0.08
77 0.08
78 0.09
79 0.07
80 0.06
81 0.08
82 0.08
83 0.1
84 0.11
85 0.1
86 0.1
87 0.1
88 0.11
89 0.1
90 0.11
91 0.12
92 0.17
93 0.19
94 0.22
95 0.3
96 0.32
97 0.35
98 0.38
99 0.44
100 0.41
101 0.41
102 0.45
103 0.39
104 0.45
105 0.49
106 0.49
107 0.41
108 0.39
109 0.41
110 0.41
111 0.41
112 0.35
113 0.29