Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7PAZ6

Protein Details
Accession M7PAZ6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-33ATSAHNKAGKAKKKWSKGKVKDKSNNTVIHydrophilic
NLS Segment(s)
PositionSequence
11-26KAGKAKKKWSKGKVKD
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKAATSAHNKAGKAKKKWSKGKVKDKSNNTVILDKQTYDRLYKDVLSYRFISISVFVDRFKINGSLARKALKALFEEGIIKKVDIHHAQTIYTRATPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.66
4 0.72
5 0.82
6 0.83
7 0.85
8 0.86
9 0.9
10 0.89
11 0.9
12 0.89
13 0.86
14 0.84
15 0.77
16 0.72
17 0.63
18 0.58
19 0.48
20 0.44
21 0.37
22 0.29
23 0.26
24 0.24
25 0.23
26 0.21
27 0.21
28 0.16
29 0.17
30 0.17
31 0.18
32 0.2
33 0.2
34 0.21
35 0.21
36 0.2
37 0.19
38 0.18
39 0.16
40 0.11
41 0.12
42 0.11
43 0.1
44 0.1
45 0.12
46 0.12
47 0.12
48 0.12
49 0.11
50 0.1
51 0.15
52 0.18
53 0.21
54 0.23
55 0.26
56 0.24
57 0.25
58 0.26
59 0.23
60 0.21
61 0.2
62 0.18
63 0.17
64 0.21
65 0.2
66 0.21
67 0.2
68 0.18
69 0.16
70 0.18
71 0.25
72 0.24
73 0.28
74 0.31
75 0.31
76 0.32
77 0.34
78 0.35
79 0.3