Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NJU2

Protein Details
Accession M7NJU2    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
122-145ISSNKKKKPLVSRIMRRTNRQEKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 11.999, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MKEMSCFTVRSAEIWKKLKTFYDLEQLDEISERFRNGGGNFLKDKNGTFDLYFTEFLLPWEEYGEIMEEHRRASDSTSTSPPHLPYGAIGLSKILEEAQEIETFQTESLEPEITDDDLQLYISSNKKKKPLVSRIMRRTNRQEKLNTSVSEKNNVLNTLPNTRTPKSEKPLQNTPSNMRRSSRNKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.45
4 0.48
5 0.5
6 0.47
7 0.43
8 0.39
9 0.43
10 0.4
11 0.4
12 0.38
13 0.33
14 0.29
15 0.26
16 0.21
17 0.14
18 0.14
19 0.12
20 0.11
21 0.11
22 0.15
23 0.14
24 0.22
25 0.22
26 0.26
27 0.29
28 0.3
29 0.32
30 0.29
31 0.3
32 0.26
33 0.26
34 0.23
35 0.2
36 0.19
37 0.19
38 0.21
39 0.21
40 0.16
41 0.15
42 0.13
43 0.13
44 0.16
45 0.13
46 0.1
47 0.1
48 0.1
49 0.08
50 0.09
51 0.09
52 0.06
53 0.07
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.12
61 0.16
62 0.16
63 0.19
64 0.23
65 0.24
66 0.25
67 0.26
68 0.24
69 0.21
70 0.18
71 0.15
72 0.11
73 0.12
74 0.11
75 0.1
76 0.09
77 0.07
78 0.07
79 0.07
80 0.07
81 0.04
82 0.03
83 0.03
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.06
93 0.05
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.09
109 0.13
110 0.21
111 0.25
112 0.29
113 0.35
114 0.39
115 0.46
116 0.53
117 0.59
118 0.62
119 0.68
120 0.75
121 0.79
122 0.86
123 0.83
124 0.8
125 0.8
126 0.8
127 0.77
128 0.73
129 0.69
130 0.64
131 0.65
132 0.65
133 0.56
134 0.51
135 0.52
136 0.48
137 0.48
138 0.43
139 0.39
140 0.35
141 0.35
142 0.3
143 0.28
144 0.3
145 0.31
146 0.32
147 0.36
148 0.39
149 0.4
150 0.46
151 0.47
152 0.53
153 0.53
154 0.61
155 0.62
156 0.63
157 0.72
158 0.71
159 0.71
160 0.68
161 0.69
162 0.68
163 0.67
164 0.63
165 0.56
166 0.61