Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P9Z0

Protein Details
Accession M7P9Z0   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-48HSDPSKKLKKIMPYERNRKRKAKEKEAISBasic
NLS Segment(s)
PositionSequence
24-44SKKLKKIMPYERNRKRKAKEK
62-73KKKKNEGNIKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKFLKDSVIIQLSPIKHLAHSDPSKKLKKIMPYERNRKRKAKEKEAISEELSNSNLVIYESKKKKNEGNIKKKSMKNEDLGLCNEGSYTLNSKTKKNNHIESKQNISFSLQEHDTKDNEYDEFIWDIENNISYNVSSDNYSLISSNLDYYSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.18
4 0.21
5 0.23
6 0.28
7 0.35
8 0.39
9 0.45
10 0.54
11 0.6
12 0.6
13 0.62
14 0.58
15 0.6
16 0.64
17 0.67
18 0.68
19 0.71
20 0.81
21 0.85
22 0.9
23 0.88
24 0.87
25 0.84
26 0.84
27 0.84
28 0.84
29 0.82
30 0.79
31 0.79
32 0.75
33 0.7
34 0.62
35 0.53
36 0.43
37 0.36
38 0.29
39 0.2
40 0.15
41 0.11
42 0.09
43 0.07
44 0.08
45 0.09
46 0.18
47 0.23
48 0.3
49 0.33
50 0.36
51 0.4
52 0.48
53 0.57
54 0.59
55 0.64
56 0.67
57 0.72
58 0.78
59 0.76
60 0.74
61 0.71
62 0.64
63 0.55
64 0.52
65 0.46
66 0.41
67 0.39
68 0.33
69 0.24
70 0.2
71 0.17
72 0.12
73 0.1
74 0.08
75 0.09
76 0.12
77 0.17
78 0.19
79 0.23
80 0.31
81 0.38
82 0.46
83 0.51
84 0.57
85 0.61
86 0.67
87 0.72
88 0.69
89 0.69
90 0.62
91 0.55
92 0.47
93 0.39
94 0.34
95 0.27
96 0.26
97 0.2
98 0.2
99 0.22
100 0.24
101 0.23
102 0.23
103 0.23
104 0.2
105 0.18
106 0.17
107 0.15
108 0.15
109 0.15
110 0.13
111 0.12
112 0.11
113 0.12
114 0.11
115 0.12
116 0.1
117 0.1
118 0.1
119 0.09
120 0.1
121 0.11
122 0.11
123 0.11
124 0.11
125 0.11
126 0.12
127 0.13
128 0.12
129 0.11
130 0.12
131 0.11
132 0.13