Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7PKN3

Protein Details
Accession M7PKN3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGKRKTKMKRPKPKPRAPLDKTFNCBasic
NLS Segment(s)
PositionSequence
3-17KRKTKMKRPKPKPRA
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKTKMKRPKPKPRAPLDKTFNCLFCNHEKSTLICKVCGQTHQSIIHNLSAPVDIYSDWIDACDAVANKTNRNLTQELNLNNNDYNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.93
4 0.88
5 0.87
6 0.85
7 0.79
8 0.74
9 0.67
10 0.58
11 0.48
12 0.43
13 0.36
14 0.34
15 0.35
16 0.31
17 0.3
18 0.3
19 0.31
20 0.37
21 0.39
22 0.32
23 0.27
24 0.27
25 0.26
26 0.27
27 0.27
28 0.24
29 0.19
30 0.23
31 0.25
32 0.25
33 0.24
34 0.24
35 0.23
36 0.2
37 0.18
38 0.14
39 0.11
40 0.11
41 0.09
42 0.08
43 0.06
44 0.07
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.08
53 0.07
54 0.09
55 0.16
56 0.17
57 0.19
58 0.25
59 0.3
60 0.28
61 0.33
62 0.34
63 0.3
64 0.36
65 0.4
66 0.39
67 0.4
68 0.4
69 0.37