Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PKL0

Protein Details
Accession M7PKL0   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
207-229RALPAPKPKTKYKRNYGLNEIRIHydrophilic
247-267AVSTPIFYKKNKKRENNRKFFHydrophilic
NLS Segment(s)
PositionSequence
157-220RHKIIENRIKLLGGKEIKEKVPFKIKLGMKLKAKIRSDIAKKKAKESGVVRALPAPKPKTKYKR
259-259K
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027973  DUF4602  
Pfam View protein in Pfam  
PF15375  DUF4602  
Amino Acid Sequences MNKTDEPKISKNFENIALKYLKKSFEDQFGSIHKFFEVKSGEKNLYEIPKLSEKVEDNVIKQEENPLEFPEVVNFLKKEKLRAVSNKNIEFHSFMSSKLPNFYEKRKSIKEVVKKQYLDYEQLKNDVALQRLLRESHLLKKGSNRSTFSLEPIGKQRHKIIENRIKLLGGKEIKEKVPFKIKLGMKLKAKIRSDIAKKKAKESGVVRALPAPKPKTKYKRNYGLNEIRIGKYHKGMITLSEKDIREAVSTPIFYKKNKKRENNRKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.47
4 0.46
5 0.43
6 0.43
7 0.43
8 0.39
9 0.34
10 0.39
11 0.37
12 0.41
13 0.45
14 0.41
15 0.41
16 0.43
17 0.46
18 0.42
19 0.38
20 0.29
21 0.25
22 0.24
23 0.27
24 0.26
25 0.22
26 0.27
27 0.32
28 0.34
29 0.33
30 0.35
31 0.33
32 0.33
33 0.33
34 0.28
35 0.26
36 0.31
37 0.32
38 0.31
39 0.31
40 0.28
41 0.29
42 0.35
43 0.34
44 0.29
45 0.34
46 0.34
47 0.29
48 0.27
49 0.31
50 0.25
51 0.25
52 0.25
53 0.2
54 0.21
55 0.21
56 0.21
57 0.15
58 0.16
59 0.14
60 0.16
61 0.15
62 0.14
63 0.2
64 0.21
65 0.24
66 0.27
67 0.32
68 0.36
69 0.45
70 0.52
71 0.55
72 0.62
73 0.61
74 0.58
75 0.53
76 0.47
77 0.4
78 0.33
79 0.29
80 0.22
81 0.18
82 0.2
83 0.21
84 0.2
85 0.21
86 0.21
87 0.22
88 0.25
89 0.31
90 0.36
91 0.39
92 0.46
93 0.47
94 0.5
95 0.52
96 0.57
97 0.6
98 0.61
99 0.64
100 0.64
101 0.61
102 0.58
103 0.56
104 0.5
105 0.45
106 0.39
107 0.36
108 0.29
109 0.3
110 0.29
111 0.22
112 0.23
113 0.2
114 0.17
115 0.15
116 0.14
117 0.14
118 0.15
119 0.15
120 0.13
121 0.13
122 0.14
123 0.19
124 0.24
125 0.24
126 0.24
127 0.31
128 0.38
129 0.42
130 0.45
131 0.41
132 0.38
133 0.42
134 0.41
135 0.36
136 0.35
137 0.29
138 0.26
139 0.3
140 0.35
141 0.31
142 0.33
143 0.35
144 0.35
145 0.38
146 0.42
147 0.46
148 0.48
149 0.51
150 0.52
151 0.48
152 0.42
153 0.39
154 0.34
155 0.31
156 0.24
157 0.22
158 0.24
159 0.26
160 0.27
161 0.33
162 0.34
163 0.31
164 0.38
165 0.38
166 0.36
167 0.42
168 0.42
169 0.45
170 0.49
171 0.52
172 0.47
173 0.52
174 0.56
175 0.55
176 0.55
177 0.49
178 0.48
179 0.5
180 0.55
181 0.57
182 0.6
183 0.6
184 0.6
185 0.62
186 0.63
187 0.55
188 0.54
189 0.48
190 0.49
191 0.48
192 0.47
193 0.43
194 0.42
195 0.44
196 0.4
197 0.44
198 0.4
199 0.39
200 0.44
201 0.54
202 0.59
203 0.66
204 0.73
205 0.75
206 0.8
207 0.83
208 0.85
209 0.85
210 0.85
211 0.78
212 0.75
213 0.68
214 0.58
215 0.53
216 0.5
217 0.42
218 0.36
219 0.37
220 0.31
221 0.3
222 0.3
223 0.32
224 0.34
225 0.34
226 0.34
227 0.36
228 0.35
229 0.33
230 0.34
231 0.29
232 0.24
233 0.23
234 0.23
235 0.21
236 0.22
237 0.23
238 0.3
239 0.32
240 0.35
241 0.45
242 0.51
243 0.57
244 0.67
245 0.76
246 0.79
247 0.87