Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PJT5

Protein Details
Accession M7PJT5   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-34SFGKRHIKTHTQCRRCGRRSFHNQKSRCHydrophilic
61-80TGRMKHLKHVYQRYKNGFRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHIKTHTQCRRCGRRSFHNQKSRCASCGYPASKMRRYNWSFKAIRRKTTGTGRMKHLKHVYQRYKNGFRTGETPRKTRLES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.72
4 0.69
5 0.75
6 0.8
7 0.82
8 0.78
9 0.79
10 0.76
11 0.76
12 0.8
13 0.83
14 0.83
15 0.82
16 0.78
17 0.77
18 0.78
19 0.69
20 0.59
21 0.51
22 0.42
23 0.37
24 0.42
25 0.36
26 0.33
27 0.37
28 0.41
29 0.44
30 0.48
31 0.45
32 0.47
33 0.49
34 0.51
35 0.5
36 0.53
37 0.5
38 0.52
39 0.61
40 0.55
41 0.56
42 0.54
43 0.52
44 0.49
45 0.55
46 0.59
47 0.56
48 0.57
49 0.59
50 0.63
51 0.6
52 0.63
53 0.6
54 0.57
55 0.58
56 0.65
57 0.68
58 0.68
59 0.77
60 0.78
61 0.8
62 0.78
63 0.76
64 0.67
65 0.59
66 0.56
67 0.57
68 0.57
69 0.53
70 0.53
71 0.52