Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NRT3

Protein Details
Accession M7NRT3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-44LLWKIPWRLSKTRKLRHRRRLRKVDLVLSTHydrophilic
NLS Segment(s)
PositionSequence
22-37RLSKTRKLRHRRRLRK
Subcellular Location(s) mito 22, mito_nucl 12.833, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGVFKPNLPAFSGLLWKIPWRLSKTRKLRHRRRLRKVDLVLSTLHTSLSKAGLSCHALERQIREITPESKMLPKNKYTVFNKKSKNFRKSIHFVPKFTRVTVMNRMFPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.2
5 0.21
6 0.24
7 0.28
8 0.3
9 0.4
10 0.45
11 0.55
12 0.64
13 0.71
14 0.77
15 0.82
16 0.86
17 0.87
18 0.91
19 0.92
20 0.92
21 0.94
22 0.91
23 0.9
24 0.84
25 0.8
26 0.71
27 0.62
28 0.51
29 0.42
30 0.35
31 0.25
32 0.2
33 0.12
34 0.1
35 0.09
36 0.1
37 0.08
38 0.07
39 0.07
40 0.09
41 0.1
42 0.11
43 0.12
44 0.12
45 0.13
46 0.14
47 0.16
48 0.18
49 0.18
50 0.17
51 0.18
52 0.2
53 0.2
54 0.21
55 0.21
56 0.18
57 0.23
58 0.28
59 0.3
60 0.32
61 0.33
62 0.37
63 0.39
64 0.47
65 0.48
66 0.54
67 0.55
68 0.59
69 0.66
70 0.68
71 0.75
72 0.76
73 0.78
74 0.74
75 0.74
76 0.75
77 0.73
78 0.75
79 0.76
80 0.71
81 0.66
82 0.64
83 0.68
84 0.6
85 0.54
86 0.49
87 0.4
88 0.41
89 0.48
90 0.48
91 0.45
92 0.44