Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7P4U0

Protein Details
Accession M7P4U0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVLHNDKWKKKASKKYHNKRGTALGHydrophilic
NLS Segment(s)
PositionSequence
8-19WKKKASKKYHNK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MVLHNDKWKKKASKKYHNKRGTALGSDLNESSARKINISSEDNHHNSDELLSNRKVNNYVETIISDEDIWVDYTKVLAKEFTLPEPDIISNDELPKNRFGKGKLVYEDAENVYHLRRQVENELSLKEIKKKYNSRVKVRTVKGLCLDMEKSESDIEDIDELLKKTEFVEKQIDDNISQEKSIQMNTIIKDKELEDFLDKLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.92
3 0.94
4 0.92
5 0.87
6 0.81
7 0.8
8 0.74
9 0.66
10 0.58
11 0.52
12 0.44
13 0.41
14 0.36
15 0.28
16 0.23
17 0.2
18 0.2
19 0.21
20 0.2
21 0.18
22 0.19
23 0.21
24 0.27
25 0.29
26 0.29
27 0.29
28 0.36
29 0.38
30 0.39
31 0.36
32 0.29
33 0.26
34 0.25
35 0.24
36 0.18
37 0.22
38 0.21
39 0.25
40 0.26
41 0.27
42 0.28
43 0.25
44 0.26
45 0.23
46 0.23
47 0.2
48 0.19
49 0.19
50 0.16
51 0.15
52 0.12
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.13
67 0.15
68 0.15
69 0.16
70 0.16
71 0.16
72 0.17
73 0.16
74 0.12
75 0.12
76 0.12
77 0.1
78 0.12
79 0.14
80 0.14
81 0.16
82 0.2
83 0.2
84 0.22
85 0.23
86 0.22
87 0.28
88 0.31
89 0.34
90 0.31
91 0.32
92 0.3
93 0.28
94 0.28
95 0.21
96 0.17
97 0.12
98 0.11
99 0.09
100 0.1
101 0.11
102 0.11
103 0.11
104 0.14
105 0.19
106 0.21
107 0.24
108 0.24
109 0.24
110 0.23
111 0.25
112 0.24
113 0.26
114 0.27
115 0.29
116 0.36
117 0.43
118 0.51
119 0.59
120 0.66
121 0.69
122 0.73
123 0.78
124 0.79
125 0.74
126 0.75
127 0.66
128 0.61
129 0.54
130 0.48
131 0.39
132 0.33
133 0.3
134 0.22
135 0.22
136 0.17
137 0.16
138 0.14
139 0.13
140 0.11
141 0.1
142 0.1
143 0.08
144 0.08
145 0.08
146 0.1
147 0.1
148 0.11
149 0.11
150 0.1
151 0.11
152 0.19
153 0.19
154 0.2
155 0.28
156 0.27
157 0.3
158 0.34
159 0.35
160 0.27
161 0.29
162 0.29
163 0.22
164 0.21
165 0.19
166 0.18
167 0.18
168 0.18
169 0.18
170 0.18
171 0.22
172 0.24
173 0.31
174 0.29
175 0.28
176 0.29
177 0.28
178 0.27
179 0.24
180 0.25
181 0.21
182 0.21