Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NUF8

Protein Details
Accession M7NUF8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-43RSTRIVKDKKKVKFKIRCSRYLYHydrophilic
NLS Segment(s)
PositionSequence
17-34RKDARSTRIVKDKKKVKF
Subcellular Location(s) nucl 16.5, cyto_nucl 13, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKQIQDIKLFLEVSRRKDARSTRIVKDKKKVKFKIRCSRYLYTLVVNDPEKAEKLKQSLPPNLPII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.4
4 0.37
5 0.44
6 0.5
7 0.48
8 0.53
9 0.54
10 0.51
11 0.61
12 0.67
13 0.67
14 0.69
15 0.69
16 0.68
17 0.72
18 0.74
19 0.74
20 0.76
21 0.81
22 0.83
23 0.8
24 0.8
25 0.77
26 0.72
27 0.65
28 0.61
29 0.51
30 0.43
31 0.39
32 0.32
33 0.28
34 0.26
35 0.23
36 0.19
37 0.19
38 0.17
39 0.19
40 0.2
41 0.21
42 0.25
43 0.31
44 0.38
45 0.44
46 0.52
47 0.53