Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZX25

Protein Details
Accession A0A0W4ZX25    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-61TLTNTCAREKRRRKKVESGQGKKVKVHydrophilic
NLS Segment(s)
PositionSequence
43-60REKRRRKKVESGQGKKVK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MFYSVLLQNIYFLCVFFDEVFKALSKRNHNRRLLHTLTNTCAREKRRRKKVESGQGKKVKVRDDILNSDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.1
4 0.11
5 0.1
6 0.1
7 0.11
8 0.11
9 0.12
10 0.15
11 0.21
12 0.29
13 0.39
14 0.49
15 0.57
16 0.63
17 0.68
18 0.69
19 0.71
20 0.65
21 0.6
22 0.54
23 0.46
24 0.42
25 0.43
26 0.38
27 0.31
28 0.32
29 0.33
30 0.4
31 0.49
32 0.57
33 0.62
34 0.71
35 0.76
36 0.82
37 0.87
38 0.87
39 0.87
40 0.84
41 0.84
42 0.83
43 0.79
44 0.73
45 0.67
46 0.61
47 0.56
48 0.53
49 0.51
50 0.5
51 0.53