Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NPH3

Protein Details
Accession M7NPH3   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTFKRRNNGRNKHGRGHTDSBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTFKRRNNGRNKHGRGHTDSIRCSNCARCVPKDKAIKRFTVRNMVESAAIRDISDASVYQEYALPKLYIKLHYCVSCAIHSHIVRVRSREGRRIRVVPLRAHYNKDGRKINPTSAAKALISQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.72
5 0.68
6 0.65
7 0.63
8 0.57
9 0.52
10 0.47
11 0.44
12 0.42
13 0.43
14 0.44
15 0.44
16 0.5
17 0.54
18 0.6
19 0.65
20 0.65
21 0.66
22 0.65
23 0.66
24 0.62
25 0.63
26 0.59
27 0.59
28 0.54
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.1
54 0.12
55 0.14
56 0.16
57 0.18
58 0.21
59 0.21
60 0.22
61 0.21
62 0.21
63 0.18
64 0.17
65 0.18
66 0.21
67 0.2
68 0.23
69 0.25
70 0.28
71 0.29
72 0.31
73 0.34
74 0.37
75 0.4
76 0.46
77 0.5
78 0.54
79 0.58
80 0.59
81 0.59
82 0.58
83 0.6
84 0.56
85 0.54
86 0.56
87 0.53
88 0.54
89 0.54
90 0.56
91 0.56
92 0.59
93 0.61
94 0.53
95 0.6
96 0.59
97 0.58
98 0.59
99 0.57
100 0.53
101 0.49
102 0.49
103 0.4