Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NPY1

Protein Details
Accession M7NPY1   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-42VLEKPFKNPHFKRNPRRNKTLRQVLMYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MVSSSHSLLDTVDIGVLEKPFKNPHFKRNPRRNKTLRQVLMYEAQLHTSTSPLSPDVPTYSNIEASPSLFPCSKWCDITGLQGLYTDPKTGLRFHNKEVFSIIKNMTQGVEQQFLQLRGSHVMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.11
4 0.11
5 0.12
6 0.14
7 0.2
8 0.24
9 0.35
10 0.38
11 0.47
12 0.56
13 0.66
14 0.75
15 0.79
16 0.87
17 0.85
18 0.91
19 0.89
20 0.88
21 0.88
22 0.88
23 0.81
24 0.74
25 0.67
26 0.58
27 0.53
28 0.44
29 0.35
30 0.25
31 0.21
32 0.17
33 0.16
34 0.13
35 0.09
36 0.09
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.11
45 0.12
46 0.14
47 0.14
48 0.14
49 0.14
50 0.14
51 0.12
52 0.12
53 0.12
54 0.09
55 0.11
56 0.11
57 0.11
58 0.13
59 0.18
60 0.19
61 0.19
62 0.19
63 0.2
64 0.21
65 0.25
66 0.26
67 0.2
68 0.18
69 0.18
70 0.17
71 0.16
72 0.16
73 0.12
74 0.09
75 0.12
76 0.13
77 0.16
78 0.24
79 0.32
80 0.34
81 0.39
82 0.47
83 0.44
84 0.43
85 0.44
86 0.4
87 0.32
88 0.33
89 0.3
90 0.24
91 0.24
92 0.24
93 0.21
94 0.18
95 0.21
96 0.19
97 0.21
98 0.18
99 0.21
100 0.25
101 0.26
102 0.26
103 0.23
104 0.22
105 0.22