Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7PHN8

Protein Details
Accession M7PHN8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-28SIIPHFRLKKLKVKPKRNRTISPCITEHydrophilic
NLS Segment(s)
PositionSequence
10-18KKLKVKPKR
Subcellular Location(s) mito 21, mito_nucl 14, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSIIPHFRLKKLKVKPKRNRTISPCITEMSAMLGCWAAHGGQPDAIACKAFVVALENCMKEKTRKNQTVNTINYHLSRLKKWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.87
4 0.92
5 0.91
6 0.9
7 0.87
8 0.87
9 0.83
10 0.76
11 0.67
12 0.57
13 0.48
14 0.38
15 0.3
16 0.22
17 0.15
18 0.1
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.04
25 0.05
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.08
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.11
42 0.14
43 0.14
44 0.15
45 0.16
46 0.18
47 0.2
48 0.29
49 0.35
50 0.44
51 0.53
52 0.58
53 0.65
54 0.73
55 0.77
56 0.73
57 0.69
58 0.62
59 0.56
60 0.51
61 0.47
62 0.42
63 0.37