Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZX15

Protein Details
Accession A0A0W4ZX15    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-108GTFICKTRQTFKKRKNNICNRKKYKTNLEEVTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MLDNIFLIFEIRVLMKMSYFQDSNTLNYIFLNKFHKYEKNILENNIYLKNNTKEMPIHNGFNIMQEKADQDIFDIGTFICKTRQTFKKRKNNICNRKKYKTNLEEVTFYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.13
4 0.15
5 0.18
6 0.18
7 0.17
8 0.21
9 0.22
10 0.24
11 0.24
12 0.22
13 0.18
14 0.18
15 0.22
16 0.16
17 0.19
18 0.22
19 0.2
20 0.21
21 0.26
22 0.31
23 0.32
24 0.39
25 0.42
26 0.46
27 0.47
28 0.46
29 0.45
30 0.4
31 0.38
32 0.35
33 0.29
34 0.2
35 0.22
36 0.22
37 0.22
38 0.21
39 0.2
40 0.17
41 0.19
42 0.26
43 0.23
44 0.23
45 0.2
46 0.22
47 0.2
48 0.23
49 0.22
50 0.15
51 0.13
52 0.12
53 0.13
54 0.12
55 0.13
56 0.08
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.06
63 0.08
64 0.09
65 0.09
66 0.11
67 0.13
68 0.16
69 0.25
70 0.34
71 0.42
72 0.53
73 0.63
74 0.71
75 0.79
76 0.88
77 0.9
78 0.92
79 0.93
80 0.94
81 0.94
82 0.93
83 0.92
84 0.89
85 0.87
86 0.87
87 0.84
88 0.83
89 0.8
90 0.75