Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7P983

Protein Details
Accession M7P983    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-98DHRPGFIDIRQKRRKYKSLKEKQSBasic
NLS Segment(s)
PositionSequence
86-94KRRKYKSLK
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018937  MMgT  
Gene Ontology GO:0016020  C:membrane  
GO:0051234  P:establishment of localization  
Pfam View protein in Pfam  
PF10270  MMgT  
Amino Acid Sequences MLFHGGYSVHEIVSLMKSIDQEVKIPIDVILEVILSLIIFCIERVFFAEKLQPISYSKYINAKKESGDLIHSILDHRPGFIDIRQKRRKYKSLKEKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.09
3 0.1
4 0.11
5 0.12
6 0.17
7 0.16
8 0.16
9 0.17
10 0.18
11 0.17
12 0.17
13 0.15
14 0.11
15 0.1
16 0.09
17 0.07
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.06
32 0.09
33 0.09
34 0.1
35 0.13
36 0.13
37 0.16
38 0.16
39 0.15
40 0.14
41 0.18
42 0.19
43 0.18
44 0.19
45 0.25
46 0.29
47 0.33
48 0.36
49 0.33
50 0.32
51 0.33
52 0.33
53 0.25
54 0.23
55 0.19
56 0.16
57 0.16
58 0.15
59 0.13
60 0.13
61 0.17
62 0.15
63 0.14
64 0.14
65 0.15
66 0.17
67 0.19
68 0.28
69 0.3
70 0.41
71 0.51
72 0.58
73 0.66
74 0.74
75 0.8
76 0.81
77 0.85
78 0.85