Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NWJ5

Protein Details
Accession M7NWJ5   
Localization Confidence High
Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MKIRGLKKNEKNTTNRPYFQKRQDKSWEKRAQQRKAHydrophilic
77-102KMKEKMHMKRIERLRRRERKSKLSQKBasic
NLS Segment(s)
PositionSequence
24-102DKSWEKRAQQRKAIQEMKEREKKIIQEKQKIQEKKKELINKKLQAKKEKERFEKMKEKMHMKRIERLRRRERKSKLSQK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MKIRGLKKNEKNTTNRPYFQKRQDKSWEKRAQQRKAIQEMKEREKKIIQEKQKIQEKKKELINKKLQAKKEKERFEKMKEKMHMKRIERLRRRERKSKLSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.75
5 0.76
6 0.78
7 0.79
8 0.71
9 0.72
10 0.76
11 0.78
12 0.76
13 0.78
14 0.77
15 0.72
16 0.79
17 0.81
18 0.78
19 0.76
20 0.76
21 0.73
22 0.73
23 0.73
24 0.66
25 0.65
26 0.64
27 0.64
28 0.65
29 0.58
30 0.51
31 0.48
32 0.49
33 0.5
34 0.51
35 0.5
36 0.51
37 0.56
38 0.62
39 0.68
40 0.69
41 0.65
42 0.65
43 0.62
44 0.58
45 0.6
46 0.61
47 0.59
48 0.63
49 0.68
50 0.67
51 0.71
52 0.72
53 0.72
54 0.72
55 0.74
56 0.74
57 0.74
58 0.76
59 0.74
60 0.78
61 0.77
62 0.77
63 0.78
64 0.73
65 0.73
66 0.7
67 0.73
68 0.7
69 0.73
70 0.73
71 0.67
72 0.71
73 0.72
74 0.76
75 0.76
76 0.79
77 0.81
78 0.82
79 0.87
80 0.88
81 0.88
82 0.87