Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7NT22

Protein Details
Accession M7NT22    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-59SDFDYYSVKKKFKKRGKIMEKIENKEKLKKEIKKKKEKINKIEDEDSBasic
NLS Segment(s)
PositionSequence
21-51KKKFKKRGKIMEKIENKEKLKKEIKKKKEKI
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MKIQEKQHKRKVSDFDYYSVKKKFKKRGKIMEKIENKEKLKKEIKKKKEKINKIEDEDSSSSSRDLDNFEETKSLKSHEECENNDLEISAKFGEAMSKIISSNVKPIYKNDPILSCCIMDISKKIQDKNIENKAKVLISMQKKEEQEKGRIKNIIPSNNDKEVSRILNYEKFLRKTAQKAVINLFNAIRAAQVKAEEASKDLKEKGVTNTIKREKEVAKMSKENFFNFIKNPKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.62
3 0.62
4 0.6
5 0.59
6 0.57
7 0.57
8 0.54
9 0.61
10 0.68
11 0.69
12 0.77
13 0.8
14 0.84
15 0.88
16 0.91
17 0.9
18 0.89
19 0.88
20 0.84
21 0.82
22 0.79
23 0.72
24 0.71
25 0.66
26 0.66
27 0.67
28 0.69
29 0.72
30 0.74
31 0.81
32 0.83
33 0.88
34 0.89
35 0.9
36 0.91
37 0.9
38 0.9
39 0.88
40 0.84
41 0.8
42 0.7
43 0.65
44 0.56
45 0.49
46 0.39
47 0.3
48 0.24
49 0.19
50 0.19
51 0.13
52 0.14
53 0.14
54 0.18
55 0.18
56 0.18
57 0.2
58 0.2
59 0.22
60 0.2
61 0.19
62 0.18
63 0.18
64 0.22
65 0.27
66 0.33
67 0.32
68 0.35
69 0.34
70 0.3
71 0.29
72 0.24
73 0.17
74 0.11
75 0.1
76 0.08
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.07
84 0.07
85 0.08
86 0.09
87 0.11
88 0.1
89 0.15
90 0.19
91 0.2
92 0.2
93 0.23
94 0.29
95 0.31
96 0.33
97 0.29
98 0.28
99 0.26
100 0.28
101 0.26
102 0.19
103 0.15
104 0.14
105 0.12
106 0.09
107 0.1
108 0.11
109 0.15
110 0.18
111 0.19
112 0.22
113 0.28
114 0.33
115 0.4
116 0.47
117 0.47
118 0.45
119 0.45
120 0.43
121 0.37
122 0.32
123 0.25
124 0.22
125 0.23
126 0.27
127 0.28
128 0.32
129 0.33
130 0.36
131 0.42
132 0.39
133 0.41
134 0.46
135 0.49
136 0.49
137 0.5
138 0.48
139 0.48
140 0.5
141 0.48
142 0.44
143 0.47
144 0.47
145 0.48
146 0.49
147 0.41
148 0.36
149 0.33
150 0.31
151 0.25
152 0.21
153 0.21
154 0.24
155 0.26
156 0.31
157 0.34
158 0.34
159 0.35
160 0.38
161 0.39
162 0.4
163 0.47
164 0.49
165 0.46
166 0.47
167 0.5
168 0.5
169 0.46
170 0.43
171 0.34
172 0.26
173 0.23
174 0.19
175 0.16
176 0.12
177 0.12
178 0.11
179 0.12
180 0.12
181 0.13
182 0.15
183 0.13
184 0.14
185 0.18
186 0.18
187 0.21
188 0.2
189 0.23
190 0.23
191 0.26
192 0.3
193 0.35
194 0.39
195 0.41
196 0.51
197 0.57
198 0.57
199 0.56
200 0.57
201 0.5
202 0.53
203 0.58
204 0.55
205 0.54
206 0.59
207 0.6
208 0.61
209 0.62
210 0.56
211 0.51
212 0.46
213 0.42
214 0.39
215 0.46