Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P6W9

Protein Details
Accession M7P6W9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
61-100YQPSNRVRKRRHGFLSRKRSASGRRILARRITKKRKYLTHHydrophilic
NLS Segment(s)
PositionSequence
66-96RVRKRRHGFLSRKRSASGRRILARRITKKRK
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MTPNMILMKNLYRKTIKKHETVLNEKNSRFQFEKSSPSLFSSPTKLWILNIKRFRTYGREYQPSNRVRKRRHGFLSRKRSASGRRILARRITKKRKYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.58
4 0.56
5 0.62
6 0.64
7 0.66
8 0.7
9 0.69
10 0.68
11 0.67
12 0.62
13 0.61
14 0.55
15 0.51
16 0.44
17 0.38
18 0.36
19 0.34
20 0.4
21 0.36
22 0.37
23 0.33
24 0.34
25 0.33
26 0.27
27 0.25
28 0.23
29 0.2
30 0.22
31 0.22
32 0.19
33 0.19
34 0.25
35 0.28
36 0.32
37 0.38
38 0.36
39 0.37
40 0.37
41 0.38
42 0.37
43 0.37
44 0.38
45 0.38
46 0.43
47 0.44
48 0.49
49 0.56
50 0.57
51 0.61
52 0.6
53 0.62
54 0.62
55 0.7
56 0.72
57 0.73
58 0.75
59 0.76
60 0.79
61 0.81
62 0.86
63 0.83
64 0.77
65 0.7
66 0.67
67 0.65
68 0.63
69 0.61
70 0.59
71 0.6
72 0.61
73 0.65
74 0.67
75 0.7
76 0.71
77 0.74
78 0.76
79 0.77
80 0.82