Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NRS6

Protein Details
Accession M7NRS6   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-37KSCDLQDKSNKKKWIKNMIWHKQNRDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKIVLWKESEKSCDLQDKSNKKKWIKNMIWHKQNRDIRNENTISSDRIGLYRHSFFGFSRKFLKKTFFLRNKIIDPFFDDISEDIIVSDSFKRKDMSLWSRKISPDFLFYLLTLKQKDFGRILLNLYYLNENIKKNPLFLSKEAYCNSMESIKISQRSKLYILKQLFYTFNYYSKLWLTVYIPKTELILGLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.5
4 0.56
5 0.63
6 0.69
7 0.74
8 0.72
9 0.78
10 0.79
11 0.8
12 0.78
13 0.78
14 0.81
15 0.83
16 0.85
17 0.84
18 0.8
19 0.79
20 0.79
21 0.74
22 0.72
23 0.69
24 0.62
25 0.64
26 0.6
27 0.5
28 0.47
29 0.44
30 0.36
31 0.3
32 0.28
33 0.19
34 0.19
35 0.2
36 0.17
37 0.2
38 0.2
39 0.2
40 0.19
41 0.2
42 0.19
43 0.27
44 0.26
45 0.24
46 0.31
47 0.34
48 0.36
49 0.38
50 0.43
51 0.4
52 0.46
53 0.54
54 0.54
55 0.55
56 0.58
57 0.59
58 0.57
59 0.56
60 0.49
61 0.38
62 0.34
63 0.3
64 0.24
65 0.2
66 0.17
67 0.12
68 0.13
69 0.12
70 0.08
71 0.06
72 0.06
73 0.06
74 0.06
75 0.08
76 0.1
77 0.1
78 0.12
79 0.13
80 0.12
81 0.15
82 0.22
83 0.3
84 0.35
85 0.39
86 0.4
87 0.42
88 0.42
89 0.42
90 0.37
91 0.28
92 0.23
93 0.2
94 0.19
95 0.17
96 0.16
97 0.17
98 0.15
99 0.17
100 0.15
101 0.14
102 0.18
103 0.18
104 0.21
105 0.2
106 0.2
107 0.2
108 0.2
109 0.22
110 0.18
111 0.17
112 0.15
113 0.15
114 0.14
115 0.11
116 0.13
117 0.15
118 0.15
119 0.17
120 0.23
121 0.23
122 0.23
123 0.27
124 0.3
125 0.31
126 0.31
127 0.37
128 0.33
129 0.38
130 0.38
131 0.35
132 0.29
133 0.25
134 0.26
135 0.2
136 0.18
137 0.15
138 0.19
139 0.22
140 0.28
141 0.28
142 0.31
143 0.31
144 0.35
145 0.37
146 0.4
147 0.4
148 0.42
149 0.44
150 0.42
151 0.41
152 0.42
153 0.39
154 0.33
155 0.35
156 0.28
157 0.28
158 0.29
159 0.27
160 0.26
161 0.26
162 0.26
163 0.2
164 0.22
165 0.22
166 0.27
167 0.3
168 0.31
169 0.3
170 0.28
171 0.29
172 0.26