Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P6J1

Protein Details
Accession M7P6J1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-122SLTRHEKSLKTLKQQKKCKYFPRRVYALEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
Amino Acid Sequences MAKASAYFLRKKSKAELEKELEELKQELLTLRVQKISGGAASKLAKISNVRRSIARIHTIINLTQRQQLRLFYKGKKYIPLDLRSKKTKASRLSLTRHEKSLKTLKQQKKCKYFPRRVYALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.66
4 0.62
5 0.61
6 0.61
7 0.54
8 0.44
9 0.36
10 0.3
11 0.22
12 0.15
13 0.13
14 0.11
15 0.11
16 0.15
17 0.17
18 0.17
19 0.18
20 0.18
21 0.18
22 0.18
23 0.17
24 0.15
25 0.12
26 0.11
27 0.14
28 0.15
29 0.15
30 0.15
31 0.14
32 0.14
33 0.17
34 0.24
35 0.28
36 0.31
37 0.31
38 0.31
39 0.34
40 0.37
41 0.36
42 0.33
43 0.26
44 0.23
45 0.25
46 0.25
47 0.24
48 0.23
49 0.2
50 0.18
51 0.22
52 0.22
53 0.21
54 0.22
55 0.25
56 0.24
57 0.29
58 0.33
59 0.33
60 0.4
61 0.45
62 0.45
63 0.47
64 0.47
65 0.49
66 0.51
67 0.53
68 0.54
69 0.55
70 0.6
71 0.59
72 0.58
73 0.56
74 0.57
75 0.58
76 0.55
77 0.55
78 0.58
79 0.6
80 0.65
81 0.68
82 0.7
83 0.65
84 0.64
85 0.61
86 0.53
87 0.53
88 0.57
89 0.53
90 0.55
91 0.63
92 0.67
93 0.72
94 0.82
95 0.84
96 0.84
97 0.87
98 0.88
99 0.88
100 0.9
101 0.9
102 0.89
103 0.86