Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NUW5

Protein Details
Accession M7NUW5   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
280-329EKLANALKKKSEKDKQKKERIRNLSSQEQRKYLDKERERKYKKLFKVIKAHydrophilic
NLS Segment(s)
PositionSequence
263-328KSIREEANKKLKKRQDEEKLANALKKKSEKDKQKKERIRNLSSQEQRKYLDKERERKYKKLFKVIK
Subcellular Location(s) plas 10, E.R. 6, vacu 3, nucl 2, cyto 2, cyto_nucl 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012879  CCDC47  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0032469  P:endoplasmic reticulum calcium ion homeostasis  
Pfam View protein in Pfam  
PF07946  CCDC47  
Amino Acid Sequences MESFFYDKCCFFFLMLYVIISEYGRLKNAFLAKKWFETLFPLLTNQFVQVGIKRNDPMPLHIRDPGYFISYATGRIHIAYLYIQFKFLVRQNFLSFIRQVVVGFFSDNPMPHDRLYIDMIVEDHVFDACVFAVVNKSKMRWLREKYYNLSFTCVMELPILPETYVVMSEFCEIASILLENNESFIQCIKTPDVVLEYLIVSDLPIKCPKSPDQTYQKTVSFCVKLPSLCYSQQVACIFSECIAFVDLLAGRAHWRSNISQKLKSIREEANKKLKKRQDEEKLANALKKKSEKDKQKKERIRNLSSQEQRKYLDKERERKYKKLFKVIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.15
5 0.14
6 0.14
7 0.12
8 0.12
9 0.12
10 0.13
11 0.15
12 0.15
13 0.16
14 0.21
15 0.29
16 0.33
17 0.33
18 0.4
19 0.41
20 0.44
21 0.47
22 0.42
23 0.34
24 0.35
25 0.36
26 0.3
27 0.27
28 0.26
29 0.23
30 0.24
31 0.24
32 0.18
33 0.15
34 0.12
35 0.13
36 0.15
37 0.23
38 0.24
39 0.27
40 0.28
41 0.28
42 0.34
43 0.33
44 0.36
45 0.33
46 0.35
47 0.35
48 0.38
49 0.38
50 0.33
51 0.35
52 0.3
53 0.26
54 0.22
55 0.19
56 0.17
57 0.16
58 0.18
59 0.16
60 0.16
61 0.13
62 0.13
63 0.14
64 0.11
65 0.11
66 0.1
67 0.13
68 0.15
69 0.15
70 0.15
71 0.14
72 0.15
73 0.18
74 0.21
75 0.23
76 0.23
77 0.27
78 0.28
79 0.32
80 0.33
81 0.33
82 0.29
83 0.23
84 0.21
85 0.18
86 0.16
87 0.12
88 0.12
89 0.09
90 0.09
91 0.08
92 0.09
93 0.1
94 0.11
95 0.14
96 0.16
97 0.17
98 0.16
99 0.18
100 0.17
101 0.18
102 0.19
103 0.16
104 0.12
105 0.11
106 0.11
107 0.11
108 0.1
109 0.08
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.08
120 0.09
121 0.12
122 0.13
123 0.14
124 0.18
125 0.23
126 0.28
127 0.33
128 0.38
129 0.43
130 0.51
131 0.56
132 0.56
133 0.58
134 0.57
135 0.49
136 0.46
137 0.38
138 0.29
139 0.26
140 0.21
141 0.15
142 0.11
143 0.1
144 0.09
145 0.09
146 0.09
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.05
153 0.04
154 0.04
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.03
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.05
171 0.06
172 0.07
173 0.08
174 0.1
175 0.1
176 0.11
177 0.11
178 0.11
179 0.12
180 0.1
181 0.1
182 0.09
183 0.08
184 0.07
185 0.07
186 0.06
187 0.04
188 0.08
189 0.08
190 0.1
191 0.14
192 0.15
193 0.17
194 0.21
195 0.26
196 0.31
197 0.35
198 0.41
199 0.48
200 0.53
201 0.57
202 0.58
203 0.56
204 0.48
205 0.45
206 0.42
207 0.34
208 0.28
209 0.27
210 0.25
211 0.22
212 0.23
213 0.26
214 0.24
215 0.23
216 0.25
217 0.24
218 0.22
219 0.27
220 0.26
221 0.23
222 0.19
223 0.2
224 0.18
225 0.15
226 0.15
227 0.1
228 0.09
229 0.09
230 0.08
231 0.06
232 0.08
233 0.08
234 0.09
235 0.08
236 0.08
237 0.09
238 0.1
239 0.11
240 0.1
241 0.13
242 0.16
243 0.26
244 0.36
245 0.4
246 0.43
247 0.48
248 0.55
249 0.57
250 0.56
251 0.53
252 0.51
253 0.55
254 0.57
255 0.61
256 0.63
257 0.66
258 0.68
259 0.71
260 0.71
261 0.71
262 0.71
263 0.73
264 0.73
265 0.76
266 0.78
267 0.77
268 0.77
269 0.71
270 0.68
271 0.63
272 0.56
273 0.53
274 0.53
275 0.52
276 0.55
277 0.61
278 0.68
279 0.74
280 0.82
281 0.85
282 0.89
283 0.93
284 0.93
285 0.94
286 0.93
287 0.9
288 0.88
289 0.84
290 0.83
291 0.83
292 0.81
293 0.76
294 0.71
295 0.66
296 0.64
297 0.64
298 0.63
299 0.64
300 0.65
301 0.69
302 0.74
303 0.82
304 0.81
305 0.83
306 0.85
307 0.84
308 0.84
309 0.85