Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PJH6

Protein Details
Accession M7PJH6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-46PKNSCISRLNIKKKKGKKQFISEKFMKKHydrophilic
NLS Segment(s)
PositionSequence
30-36KKKKGKK
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MVSKYSNKFHLKHNILKNPKNSCISRLNIKKKKGKKQFISEKFMKKLDDMTLDLYTLGLMKNSNTLQNIKKKTEKPSDIKTSYLDILAQVENNINSLQVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.78
4 0.78
5 0.74
6 0.73
7 0.71
8 0.62
9 0.57
10 0.55
11 0.52
12 0.54
13 0.57
14 0.62
15 0.62
16 0.69
17 0.73
18 0.76
19 0.83
20 0.83
21 0.84
22 0.81
23 0.84
24 0.87
25 0.86
26 0.85
27 0.81
28 0.77
29 0.7
30 0.63
31 0.53
32 0.42
33 0.36
34 0.29
35 0.25
36 0.19
37 0.18
38 0.16
39 0.15
40 0.14
41 0.12
42 0.09
43 0.07
44 0.06
45 0.04
46 0.04
47 0.04
48 0.08
49 0.09
50 0.11
51 0.12
52 0.17
53 0.23
54 0.31
55 0.37
56 0.39
57 0.47
58 0.5
59 0.57
60 0.64
61 0.66
62 0.64
63 0.68
64 0.73
65 0.67
66 0.63
67 0.56
68 0.49
69 0.42
70 0.35
71 0.26
72 0.16
73 0.17
74 0.16
75 0.14
76 0.11
77 0.13
78 0.12
79 0.13
80 0.13
81 0.1