Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RU36

Protein Details
Accession F4RU36    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-124PLDLRPKKTRAIRRRLTKHEKHLRTEKQKKKDIHFPKRKYALKABasic
NLS Segment(s)
PositionSequence
83-124DLRPKKTRAIRRRLTKHEKHLRTEKQKKKDIHFPKRKYALKA
Subcellular Location(s) nucl 18.5, mito_nucl 12.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_89643  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MATKVRAHELVTKSKADLTKQLEELKTELVALRVQKVVGGSSSKLTRINAVRKAIARVLTVIQAKTRENLREFYKGKKYQPLDLRPKKTRAIRRRLTKHEKHLRTEKQKKKDIHFPKRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.37
4 0.39
5 0.36
6 0.39
7 0.41
8 0.46
9 0.42
10 0.4
11 0.39
12 0.32
13 0.25
14 0.2
15 0.17
16 0.12
17 0.13
18 0.13
19 0.14
20 0.13
21 0.13
22 0.13
23 0.13
24 0.12
25 0.11
26 0.12
27 0.11
28 0.13
29 0.14
30 0.15
31 0.16
32 0.16
33 0.19
34 0.24
35 0.3
36 0.33
37 0.34
38 0.35
39 0.35
40 0.37
41 0.34
42 0.29
43 0.22
44 0.18
45 0.16
46 0.17
47 0.17
48 0.15
49 0.14
50 0.14
51 0.14
52 0.15
53 0.18
54 0.18
55 0.19
56 0.22
57 0.24
58 0.31
59 0.33
60 0.37
61 0.44
62 0.45
63 0.47
64 0.52
65 0.51
66 0.5
67 0.57
68 0.61
69 0.62
70 0.66
71 0.72
72 0.7
73 0.72
74 0.71
75 0.71
76 0.72
77 0.71
78 0.73
79 0.73
80 0.78
81 0.83
82 0.87
83 0.89
84 0.87
85 0.88
86 0.88
87 0.85
88 0.83
89 0.83
90 0.83
91 0.84
92 0.86
93 0.85
94 0.84
95 0.86
96 0.85
97 0.82
98 0.82
99 0.82
100 0.83
101 0.84
102 0.81
103 0.84
104 0.86