Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RUL1

Protein Details
Accession F4RUL1   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
254-273AKTQKTQKSAPKAKPTNIISHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 8.5, pero 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_108877  -  
Amino Acid Sequences MEVDDVSDTGQKEQGVPKNTAPTRDASNAFINPCGPQEKAKPTEPPTPLVFDKACLRQGLSQSPSIQSSDLGNFAKKRSRLDTPGIIAMDQASELTGSPRTNRMQDLFPGGAESRSLKEMVGKLLEVIKAGFPLANKSKKAQKISVDVETAADILVLTGAVYDKVMYDDARRNFTTPAALAGAESKSRPIIFKGKATDDTLAALTEQMAYLTSAVENLQPKQQQKKGPTAPSYALAASKHAPQTTSDSQKANQAKTQKTQKSAPKAKPTNIISLGLSDQAQTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.37
4 0.39
5 0.47
6 0.49
7 0.5
8 0.44
9 0.4
10 0.41
11 0.43
12 0.41
13 0.35
14 0.38
15 0.37
16 0.36
17 0.35
18 0.29
19 0.24
20 0.25
21 0.24
22 0.2
23 0.21
24 0.27
25 0.35
26 0.39
27 0.43
28 0.48
29 0.51
30 0.59
31 0.56
32 0.53
33 0.47
34 0.47
35 0.44
36 0.41
37 0.35
38 0.29
39 0.32
40 0.32
41 0.32
42 0.27
43 0.28
44 0.28
45 0.31
46 0.36
47 0.33
48 0.32
49 0.31
50 0.32
51 0.32
52 0.29
53 0.25
54 0.18
55 0.17
56 0.15
57 0.17
58 0.17
59 0.18
60 0.19
61 0.22
62 0.28
63 0.28
64 0.31
65 0.32
66 0.38
67 0.4
68 0.45
69 0.47
70 0.43
71 0.44
72 0.4
73 0.35
74 0.28
75 0.23
76 0.16
77 0.11
78 0.08
79 0.04
80 0.04
81 0.04
82 0.05
83 0.07
84 0.08
85 0.09
86 0.14
87 0.16
88 0.18
89 0.21
90 0.22
91 0.22
92 0.23
93 0.27
94 0.22
95 0.2
96 0.19
97 0.17
98 0.15
99 0.13
100 0.13
101 0.09
102 0.09
103 0.1
104 0.08
105 0.11
106 0.12
107 0.13
108 0.13
109 0.11
110 0.11
111 0.13
112 0.13
113 0.1
114 0.09
115 0.07
116 0.07
117 0.07
118 0.07
119 0.05
120 0.1
121 0.17
122 0.21
123 0.22
124 0.24
125 0.32
126 0.37
127 0.41
128 0.4
129 0.38
130 0.41
131 0.43
132 0.43
133 0.36
134 0.31
135 0.27
136 0.22
137 0.18
138 0.1
139 0.07
140 0.04
141 0.03
142 0.03
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.03
149 0.03
150 0.03
151 0.04
152 0.05
153 0.05
154 0.08
155 0.15
156 0.17
157 0.22
158 0.22
159 0.23
160 0.23
161 0.24
162 0.22
163 0.16
164 0.15
165 0.11
166 0.11
167 0.09
168 0.1
169 0.11
170 0.1
171 0.09
172 0.09
173 0.09
174 0.1
175 0.11
176 0.13
177 0.2
178 0.22
179 0.28
180 0.31
181 0.34
182 0.36
183 0.37
184 0.35
185 0.27
186 0.25
187 0.2
188 0.16
189 0.12
190 0.1
191 0.07
192 0.06
193 0.06
194 0.04
195 0.04
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.09
203 0.11
204 0.12
205 0.18
206 0.22
207 0.28
208 0.37
209 0.43
210 0.47
211 0.5
212 0.59
213 0.62
214 0.66
215 0.65
216 0.6
217 0.56
218 0.51
219 0.48
220 0.38
221 0.32
222 0.24
223 0.22
224 0.19
225 0.22
226 0.23
227 0.22
228 0.22
229 0.22
230 0.3
231 0.36
232 0.42
233 0.41
234 0.4
235 0.41
236 0.49
237 0.53
238 0.48
239 0.45
240 0.45
241 0.48
242 0.54
243 0.64
244 0.62
245 0.62
246 0.67
247 0.71
248 0.74
249 0.78
250 0.78
251 0.78
252 0.79
253 0.79
254 0.8
255 0.74
256 0.72
257 0.65
258 0.58
259 0.47
260 0.42
261 0.37
262 0.3
263 0.26
264 0.17