Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RKP8

Protein Details
Accession F4RKP8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-63QPSQIKRKRRHGFLARLKTKTGRKILWTRKAKGRKYBasic
NLS Segment(s)
PositionSequence
33-62KRKRRHGFLARLKTKTGRKILWTRKAKGRK
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_35640  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences QIATLALPFINPWQIGSTRCISRGHTYQPSQIKRKRRHGFLARLKTKTGRKILWTRKAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.23
5 0.22
6 0.24
7 0.25
8 0.25
9 0.29
10 0.32
11 0.35
12 0.37
13 0.37
14 0.42
15 0.49
16 0.52
17 0.55
18 0.57
19 0.6
20 0.62
21 0.71
22 0.72
23 0.69
24 0.73
25 0.73
26 0.78
27 0.78
28 0.81
29 0.76
30 0.71
31 0.67
32 0.64
33 0.61
34 0.59
35 0.56
36 0.49
37 0.5
38 0.59
39 0.67
40 0.71
41 0.73
42 0.71
43 0.75
44 0.81
45 0.79
46 0.79