Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RYW4

Protein Details
Accession F4RYW4    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHKNGIKRPATHydrophilic
NLS Segment(s)
PositionSequence
14-56KKAHKNGIKRPATGRYPSLKGVDSKFRRNQKFAKAGTLKATRA
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_38616  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIKRPATGRYPSLKGVDSKFRRNQKFAKAGTLKATRAAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.8
5 0.79
6 0.79
7 0.83
8 0.77
9 0.7
10 0.65
11 0.63
12 0.58
13 0.51
14 0.46
15 0.4
16 0.38
17 0.37
18 0.35
19 0.29
20 0.27
21 0.28
22 0.33
23 0.33
24 0.39
25 0.45
26 0.53
27 0.57
28 0.61
29 0.64
30 0.64
31 0.69
32 0.62
33 0.65
34 0.59
35 0.56
36 0.58
37 0.57
38 0.48
39 0.46
40 0.48