FuNGI

A0A1D8PP44

Protein Details

Accession

A0A1D8PP44

Localization Confidence

Medium

Confidence Score

10.3

NoLS Segment(s)

Position	Sequence	Protein Nature
76-105	NEKAVRIWFQNRRAKQRKFERQMLRKETDS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 22, cyto_nucl 14.5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR047152 Caudal_homeobox IPR009057 Homeobox-like_sf IPR017970 Homeobox_CS IPR001356 Homeobox_dom
Gene Ontology	GO:0005634 C:nucleus GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0003700 F:DNA-binding transcription factor activity GO:0000977 F:RNA polymerase II transcription regulatory region sequence-specific DNA binding GO:0046084 P:adenine biosynthetic process GO:0009887 P:animal organ morphogenesis GO:0009948 P:anterior/posterior axis specification GO:0030154 P:cell differentiation GO:0030447 P:filamentous growth GO:0044182 P:filamentous growth of a population of unicellular organisms GO:1900373 P:positive regulation of purine nucleotide biosynthetic process GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	cal:CAALFM_C505080WA -
Pfam	View protein in Pfam PF00046 Homeodomain
PROSITE	View protein in PROSITE PS00027 HOMEOBOX_1 PS50071 HOMEOBOX_2
CDD	cd00086 homeodomain

Amino Acid Sequences

MSPDSISSSVNQDLSTPTPPTSLSSTSTNSNTNASSGQKRIRATGEALEFLISEFETNPNPSPERRKFISDKAQMNEKAVRIWFQNRRAKQRKFERQMLRKETDSPGNYAGIYNTYTPNPPTVTTDMTNFNVNGSAGGATADFNDKLKNISSIPVEVNEKYCFIDCRSLSVGSWQRIKTGFHQSNLLTNNLINLAPVTLNQVMSNADLLIILSKKNLELNYFFSAISNNSRILFRIFYPLNAVVKCSLFDNNYYQNNNTNGTNSSDDNNISEIRLNLCQKPKFSVYFFNGSNTNNQWSICDDFSEGQQVSCAFAANDNSLPSNGKNQSFSNTIPHVLVGSTLSLQYLSQFILQHQQRQRQQQRQAQPQPQPQPHNQFDFNSQPFETIPTSAINNNFNTTKTVNSSSMQGFVPGDFQDLPAIYESISNSNHTTTTDLKDTNATTTTTNKHTPSSTTFTPQNLNGSNQSQTNVTYTNNYNESPFSIASTTNNNNTNSNRSNSQSHNPIFSDQLFYESSESASTNSPQFAMKKMNSETKLYINGNVSSNSSTNGPPLDDDNNLFDGVTRFTTTETSPEDDIIGMFTSQAHEPSAFELANGVTSSGSSYTHINNGSLTKSDKTFTGLSETSNNNNNTNGINFVDDFHVGNEFGDIDFEHHYSQDHHQQQQKNDNNNGNTNLDSFIDFEN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.26
3	0.23
4	0.21
5	0.21
6	0.22
7	0.24
8	0.26
9	0.25
10	0.24
11	0.27
12	0.29
13	0.33
14	0.35
15	0.35
16	0.32
17	0.32
18	0.29
19	0.26
20	0.27
21	0.28
22	0.31
23	0.34
24	0.4
25	0.42
26	0.43
27	0.46
28	0.46
29	0.44
30	0.41
31	0.42
32	0.38
33	0.34
34	0.33
35	0.28
36	0.24
37	0.21
38	0.18
39	0.11
40	0.08
41	0.08
42	0.1
43	0.12
44	0.15
45	0.18
46	0.22
47	0.25
48	0.3
49	0.4
50	0.46
51	0.51
52	0.51
53	0.57
54	0.58
55	0.65
56	0.7
57	0.68
58	0.68
59	0.65
60	0.7
61	0.63
62	0.62
63	0.57
64	0.47
65	0.43
66	0.37
67	0.35
68	0.31
69	0.39
70	0.43
71	0.47
72	0.57
73	0.6
74	0.7
75	0.78
76	0.81
77	0.82
78	0.85
79	0.87
80	0.85
81	0.88
82	0.87
83	0.87
84	0.89
85	0.87
86	0.81
87	0.71
88	0.67
89	0.62
90	0.6
91	0.53
92	0.46
93	0.39
94	0.35
95	0.33
96	0.28
97	0.24
98	0.17
99	0.16
100	0.14
101	0.15
102	0.15
103	0.17
104	0.18
105	0.2
106	0.2
107	0.2
108	0.23
109	0.24
110	0.26
111	0.26
112	0.28
113	0.29
114	0.28
115	0.3
116	0.25
117	0.22
118	0.19
119	0.17
120	0.14
121	0.11
122	0.09
123	0.07
124	0.07
125	0.07
126	0.06
127	0.07
128	0.09
129	0.09
130	0.09
131	0.1
132	0.11
133	0.12
134	0.13
135	0.15
136	0.13
137	0.17
138	0.18
139	0.2
140	0.2
141	0.22
142	0.24
143	0.22
144	0.25
145	0.22
146	0.21
147	0.19
148	0.19
149	0.18
150	0.17
151	0.24
152	0.21
153	0.25
154	0.27
155	0.27
156	0.26
157	0.32
158	0.37
159	0.33
160	0.39
161	0.34
162	0.35
163	0.36
164	0.39
165	0.36
166	0.4
167	0.4
168	0.35
169	0.4
170	0.37
171	0.41
172	0.4
173	0.36
174	0.25
175	0.2
176	0.2
177	0.17
178	0.16
179	0.09
180	0.08
181	0.07
182	0.07
183	0.07
184	0.1
185	0.1
186	0.1
187	0.1
188	0.11
189	0.11
190	0.11
191	0.11
192	0.07
193	0.06
194	0.05
195	0.05
196	0.07
197	0.07
198	0.06
199	0.07
200	0.07
201	0.08
202	0.11
203	0.12
204	0.13
205	0.14
206	0.19
207	0.22
208	0.22
209	0.22
210	0.19
211	0.19
212	0.18
213	0.2
214	0.17
215	0.14
216	0.14
217	0.15
218	0.15
219	0.16
220	0.16
221	0.13
222	0.19
223	0.18
224	0.17
225	0.21
226	0.23
227	0.24
228	0.23
229	0.23
230	0.17
231	0.17
232	0.17
233	0.15
234	0.14
235	0.12
236	0.14
237	0.17
238	0.22
239	0.26
240	0.28
241	0.27
242	0.3
243	0.31
244	0.31
245	0.26
246	0.22
247	0.19
248	0.2
249	0.21
250	0.17
251	0.17
252	0.16
253	0.16
254	0.15
255	0.15
256	0.13
257	0.11
258	0.11
259	0.1
260	0.11
261	0.15
262	0.17
263	0.2
264	0.27
265	0.29
266	0.29
267	0.32
268	0.34
269	0.32
270	0.32
271	0.34
272	0.31
273	0.34
274	0.33
275	0.31
276	0.3
277	0.28
278	0.29
279	0.23
280	0.22
281	0.18
282	0.17
283	0.16
284	0.16
285	0.18
286	0.14
287	0.13
288	0.12
289	0.11
290	0.12
291	0.15
292	0.13
293	0.1
294	0.11
295	0.1
296	0.1
297	0.09
298	0.09
299	0.05
300	0.06
301	0.08
302	0.08
303	0.09
304	0.08
305	0.09
306	0.09
307	0.1
308	0.09
309	0.15
310	0.17
311	0.17
312	0.19
313	0.19
314	0.22
315	0.24
316	0.24
317	0.22
318	0.2
319	0.2
320	0.18
321	0.17
322	0.14
323	0.11
324	0.1
325	0.06
326	0.05
327	0.05
328	0.05
329	0.05
330	0.04
331	0.04
332	0.04
333	0.05
334	0.05
335	0.06
336	0.07
337	0.07
338	0.15
339	0.16
340	0.23
341	0.28
342	0.35
343	0.38
344	0.49
345	0.58
346	0.58
347	0.67
348	0.67
349	0.72
350	0.74
351	0.78
352	0.75
353	0.73
354	0.72
355	0.72
356	0.7
357	0.66
358	0.61
359	0.61
360	0.57
361	0.53
362	0.47
363	0.4
364	0.38
365	0.4
366	0.35
367	0.29
368	0.26
369	0.22
370	0.2
371	0.22
372	0.18
373	0.12
374	0.12
375	0.1
376	0.11
377	0.13
378	0.15
379	0.15
380	0.15
381	0.17
382	0.16
383	0.16
384	0.18
385	0.16
386	0.15
387	0.16
388	0.19
389	0.19
390	0.18
391	0.21
392	0.19
393	0.2
394	0.19
395	0.16
396	0.13
397	0.12
398	0.12
399	0.09
400	0.1
401	0.08
402	0.08
403	0.08
404	0.08
405	0.09
406	0.08
407	0.08
408	0.06
409	0.07
410	0.08
411	0.1
412	0.11
413	0.12
414	0.12
415	0.13
416	0.13
417	0.12
418	0.14
419	0.14
420	0.16
421	0.18
422	0.18
423	0.18
424	0.2
425	0.2
426	0.19
427	0.18
428	0.16
429	0.14
430	0.17
431	0.2
432	0.22
433	0.26
434	0.25
435	0.26
436	0.26
437	0.28
438	0.29
439	0.32
440	0.29
441	0.3
442	0.31
443	0.31
444	0.33
445	0.31
446	0.3
447	0.26
448	0.27
449	0.25
450	0.25
451	0.24
452	0.22
453	0.22
454	0.18
455	0.17
456	0.16
457	0.14
458	0.13
459	0.15
460	0.17
461	0.2
462	0.21
463	0.21
464	0.2
465	0.19
466	0.2
467	0.18
468	0.16
469	0.14
470	0.12
471	0.12
472	0.13
473	0.19
474	0.2
475	0.23
476	0.27
477	0.28
478	0.3
479	0.32
480	0.38
481	0.35
482	0.36
483	0.34
484	0.33
485	0.37
486	0.38
487	0.42
488	0.44
489	0.42
490	0.42
491	0.4
492	0.38
493	0.35
494	0.31
495	0.29
496	0.2
497	0.22
498	0.18
499	0.18
500	0.18
501	0.16
502	0.15
503	0.12
504	0.13
505	0.11
506	0.12
507	0.13
508	0.13
509	0.13
510	0.14
511	0.16
512	0.16
513	0.19
514	0.24
515	0.24
516	0.29
517	0.33
518	0.41
519	0.4
520	0.43
521	0.42
522	0.38
523	0.44
524	0.38
525	0.38
526	0.32
527	0.32
528	0.3
529	0.29
530	0.27
531	0.22
532	0.21
533	0.19
534	0.18
535	0.15
536	0.15
537	0.16
538	0.14
539	0.13
540	0.16
541	0.18
542	0.17
543	0.18
544	0.19
545	0.2
546	0.19
547	0.18
548	0.16
549	0.14
550	0.14
551	0.14
552	0.12
553	0.11
554	0.12
555	0.15
556	0.14
557	0.17
558	0.19
559	0.21
560	0.2
561	0.2
562	0.2
563	0.18
564	0.17
565	0.14
566	0.11
567	0.08
568	0.07
569	0.07
570	0.09
571	0.09
572	0.1
573	0.1
574	0.1
575	0.11
576	0.13
577	0.16
578	0.13
579	0.12
580	0.13
581	0.12
582	0.13
583	0.12
584	0.11
585	0.07
586	0.07
587	0.09
588	0.08
589	0.09
590	0.09
591	0.11
592	0.13
593	0.18
594	0.19
595	0.18
596	0.2
597	0.21
598	0.22
599	0.22
600	0.23
601	0.22
602	0.22
603	0.23
604	0.22
605	0.24
606	0.24
607	0.22
608	0.26
609	0.24
610	0.24
611	0.3
612	0.32
613	0.32
614	0.38
615	0.39
616	0.33
617	0.34
618	0.33
619	0.28
620	0.26
621	0.24
622	0.18
623	0.18
624	0.17
625	0.17
626	0.18
627	0.17
628	0.16
629	0.15
630	0.15
631	0.13
632	0.13
633	0.12
634	0.1
635	0.09
636	0.09
637	0.09
638	0.09
639	0.11
640	0.13
641	0.13
642	0.12
643	0.14
644	0.17
645	0.23
646	0.31
647	0.36
648	0.43
649	0.5
650	0.57
651	0.64
652	0.71
653	0.74
654	0.73
655	0.74
656	0.75
657	0.73
658	0.72
659	0.67
660	0.59
661	0.51
662	0.44
663	0.37
664	0.29
665	0.24

A0A1D8PP44

3D AlphaFold-predicted Structure Viewer