Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R3N8

Protein Details
Accession F4R3N8   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-24QSYSTGTHPRRVKKFRSTFTPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
KEGG mlr:MELLADRAFT_101116  -  
Amino Acid Sequences MQSYSTGTHPRRVKKFRSTFTPSAEVSNSAVKLSVKIWISEDQQPDNIRTSNFDDPALAAEHITRFALLAHPYGRLGGSSRDPVIRRLAFHLASLNWMVVLFDARGIGSSTGRASWTWVLGYSHGALVASASTPILLPADAPRLKTPLLLISYPVSYIWALTSFNASHFEKALQAQLTGSDEELLIIYGDSDQFTSQKAYRKWLDRLKSDISPAILQKNHLSTFEAKTDHFWNGSYSTLCQVVREWLTRTTVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.81
4 0.83
5 0.83
6 0.78
7 0.76
8 0.72
9 0.62
10 0.56
11 0.49
12 0.41
13 0.34
14 0.32
15 0.26
16 0.2
17 0.21
18 0.17
19 0.17
20 0.16
21 0.2
22 0.16
23 0.17
24 0.19
25 0.22
26 0.26
27 0.31
28 0.34
29 0.31
30 0.34
31 0.35
32 0.34
33 0.33
34 0.31
35 0.25
36 0.25
37 0.28
38 0.3
39 0.29
40 0.27
41 0.24
42 0.22
43 0.23
44 0.22
45 0.16
46 0.1
47 0.1
48 0.1
49 0.11
50 0.1
51 0.08
52 0.06
53 0.07
54 0.1
55 0.1
56 0.12
57 0.12
58 0.13
59 0.13
60 0.13
61 0.13
62 0.1
63 0.11
64 0.11
65 0.13
66 0.15
67 0.16
68 0.2
69 0.21
70 0.23
71 0.29
72 0.27
73 0.25
74 0.27
75 0.3
76 0.26
77 0.26
78 0.26
79 0.18
80 0.19
81 0.18
82 0.13
83 0.09
84 0.08
85 0.08
86 0.05
87 0.06
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.05
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.08
105 0.09
106 0.09
107 0.09
108 0.1
109 0.08
110 0.07
111 0.07
112 0.06
113 0.05
114 0.05
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.05
126 0.11
127 0.12
128 0.14
129 0.14
130 0.16
131 0.16
132 0.16
133 0.16
134 0.14
135 0.15
136 0.14
137 0.15
138 0.14
139 0.14
140 0.14
141 0.13
142 0.1
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.09
150 0.08
151 0.09
152 0.14
153 0.14
154 0.14
155 0.14
156 0.14
157 0.14
158 0.15
159 0.17
160 0.13
161 0.13
162 0.12
163 0.12
164 0.14
165 0.12
166 0.12
167 0.08
168 0.07
169 0.07
170 0.07
171 0.06
172 0.05
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.07
182 0.11
183 0.14
184 0.22
185 0.24
186 0.31
187 0.38
188 0.44
189 0.52
190 0.57
191 0.62
192 0.59
193 0.63
194 0.61
195 0.56
196 0.52
197 0.46
198 0.4
199 0.36
200 0.33
201 0.34
202 0.3
203 0.3
204 0.31
205 0.33
206 0.32
207 0.29
208 0.3
209 0.27
210 0.3
211 0.33
212 0.31
213 0.27
214 0.29
215 0.31
216 0.31
217 0.27
218 0.24
219 0.22
220 0.21
221 0.24
222 0.21
223 0.2
224 0.19
225 0.23
226 0.22
227 0.2
228 0.2
229 0.25
230 0.28
231 0.3
232 0.3
233 0.29