Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RXN9

Protein Details
Accession F4RXN9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-32TIGMKMIQPKKKTKIKRKSLLKTLYVLHydrophilic
NLS Segment(s)
PositionSequence
14-23PKKKTKIKRK
Subcellular Location(s) mito 19, mito_nucl 12.833, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_109799  -  
Amino Acid Sequences MTVMETIGMKMIQPKKKTKIKRKSLLKTLYVLPTLANYATVGLDWTDAYQAKVLAGCKIHSTNRPSVKIISEAQALHDTFQQALKMLSLAGKVSYPTLKTALFLGPNQPALTSYYTYQTYSKKNTKDTPSNHIGSLNATCKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.65
4 0.76
5 0.78
6 0.81
7 0.85
8 0.88
9 0.91
10 0.91
11 0.91
12 0.88
13 0.81
14 0.73
15 0.67
16 0.61
17 0.5
18 0.4
19 0.3
20 0.23
21 0.2
22 0.17
23 0.12
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.12
45 0.15
46 0.18
47 0.21
48 0.26
49 0.31
50 0.37
51 0.39
52 0.38
53 0.36
54 0.35
55 0.32
56 0.29
57 0.23
58 0.18
59 0.16
60 0.16
61 0.17
62 0.16
63 0.13
64 0.13
65 0.12
66 0.1
67 0.11
68 0.1
69 0.07
70 0.08
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.09
82 0.09
83 0.11
84 0.13
85 0.12
86 0.13
87 0.14
88 0.15
89 0.15
90 0.15
91 0.17
92 0.17
93 0.19
94 0.18
95 0.17
96 0.15
97 0.16
98 0.17
99 0.16
100 0.14
101 0.17
102 0.18
103 0.2
104 0.23
105 0.26
106 0.3
107 0.38
108 0.45
109 0.47
110 0.54
111 0.61
112 0.66
113 0.7
114 0.69
115 0.69
116 0.68
117 0.65
118 0.58
119 0.51
120 0.42
121 0.36
122 0.37
123 0.34